DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxc3

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_002936696.1 Gene:hoxc3 / 100190990 XenbaseID:XB-GENE-5997986 Length:394 Species:Xenopus tropicalis


Alignment Length:238 Identity:71/238 - (29%)
Similarity:98/238 - (41%) Gaps:41/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRG-GSAGG--- 185
            ||.|..||    |.....||.:.......:|..|.|.       ||:.|| .||:| .|..|   
 Frog    16 GGCGFQGN----NGMGYLGQQDYPSEDDYQPPFCLPP-------DTANGS-ASHKGEHSIKGIDF 68

  Fly   186 ---NVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASN--HTFYPWMAI 245
               .||.......:....|.:..:.:..:..:..:....::...:.:...:.||  ...:|||  
 Frog    69 HLSEVSEQAQQPKSPNSDSPLPKSASTQSCTSKKSTGPVSSDVTSPNKKSKGSNMPKQIFPWM-- 131

  Fly   246 AGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLEL 310
                .|....||.:.........:..:...:..|.:              :|.|..||..|.:||
 Frog   132 ----KETRQNSKQKKQAPPPADDAPAVDSSFLSSAS--------------KRARTAYTNSQLVEL 178

  Fly   311 EKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 353
            |||||.|.||.|.||:|||..|.|:||||||||||||||.||:
 Frog   179 EKEFHFNRYLCRPRRLEMAKLLNLSERQIKIWFQNRRMKFKKD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 36/52 (69%)
hoxc3XP_002936696.1 Homeobox 167..220 CDD:395001 36/52 (69%)
DUF4074 335..392 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.