DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxb5

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001094494.1 Gene:hoxb5 / 100113366 XenbaseID:XB-GENE-1005991 Length:258 Species:Xenopus tropicalis


Alignment Length:264 Identity:83/264 - (31%)
Similarity:104/264 - (39%) Gaps:109/264 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 PDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAW------------ 212
            ||..|..| .|...|.:|.....|.|::..|....|..|:...|..|.|.::.            
 Frog    17 PDYHVLNY-GTGSSSNLSGSYREAAGSMQPSAYGYNYNGMDLSVSRAAASSSHYGDSAFPGQESR 80

  Fly   213 ---NANC------------------------TISGAAAQ------TAAASSLHQAS--------- 235
               |.:|                        |.:|::||      |:|:|...::|         
 Frog    81 FRANQSCPLATPDPLPCAKSHKDELSPTDPATSAGSSAQFTEVEETSASSETEESSTPRSSAPPR 145

  Fly   236 ----------------NHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSL 284
                            |...:|||          .|..|..|:|                     
 Frog   146 ALQENSSPGAAGTDGQNPQIFPWM----------RKLHINHDMT--------------------- 179

  Fly   285 LPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMK 349
                 |.:|  :|.|..||||||||||||||.|.|||||||||:||||||:||||||||||||||
 Frog   180 -----GPDG--KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMK 237

  Fly   350 LKKE 353
            .||:
 Frog   238 WKKD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 45/52 (87%)
hoxb5NP_001094494.1 Homeobox 187..240 CDD:365835 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.