DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxa2

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_004915456.1 Gene:hoxa2 / 100038099 XenbaseID:XB-GENE-488087 Length:373 Species:Xenopus tropicalis


Alignment Length:108 Identity:48/108 - (44%)
Similarity:65/108 - (60%) Gaps:9/108 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 TNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQ 355
            ::|..||.|..||..|.||||||||.|.||.|.||:|:|..|.|||||:|:||||||||.|::.|
 Frog   136 SSGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQ 200

  Fly   356 A---------IKELNEQEKQAQAQKAAAAAAAAAAVQGGHLDQ 389
            .         .|.|::.||..:.::.:....|..:|.|..|::
 Frog   201 CKENQNGDGKFKHLDDSEKGEEEKEKSLFEQALNSVSGALLER 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 35/52 (67%)
hoxa2XP_004915456.1 Homeobox 144..197 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.