DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxd10

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_031749087.1 Gene:hoxd10 / 100038085 XenbaseID:XB-GENE-485204 Length:274 Species:Xenopus tropicalis


Alignment Length:103 Identity:41/103 - (39%)
Similarity:57/103 - (55%) Gaps:13/103 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 PTKSKIRSD--LTQYGGISTDMGK-RYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEF 314
            |||:....|  :|......|..|: ..|.|.|...|          |:.|..|::||..|||:||
 Frog   167 PTKAPSTQDKKVTNDSSPGTPSGEAEKSNSSASQRL----------RKKRCPYSKYQIRELEREF 221

  Fly   315 HTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 352
            ..|.|:.:.:|::::..|.||:||:||||||||||.||
 Frog   222 FFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 27/52 (52%)
hoxd10XP_031749087.1 DUF3528 41..163 CDD:403310
Homeobox 205..259 CDD:395001 27/53 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.