DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and st14b

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_005161261.1 Gene:st14b / 777629 ZFINID:ZDB-GENE-061103-613 Length:864 Species:Danio rerio


Alignment Length:587 Identity:143/587 - (24%)
Similarity:200/587 - (34%) Gaps:245/587 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QFECDNGSCISQYDVCNGEKNCPDGSDETALTCVSQRQHCTKPYFQCTYGACVIGTAGCNGVNEC 95
            :|||||..|||....|:|..:|.|.|||..  |:     |.:...||..|.|.....||:|||:|
Zfish   467 RFECDNDLCISSDQHCDGYNDCGDMSDERG--C
M-----CNETQIQCKNGFCKPSFWGCDGVNDC 524

  Fly    96 ADGSDETRLRCGNEDDIRQHDRRLQGNCKENEFKCPSGICLDKSNFLCDGKDDCADGTGFDESVE 160
            .|.:||.  .|              ||||..||:|.||.|:.... .|:|.:||.||:  |||  
Zfish   525 GDNTDEE--NC--------------GNCKTWEFRCRSGRCISAQK-QCNGYNDCGDGS--DES-- 568

  Fly   161 LCGH---MECPAYSFKCGTGGCISG-SLSCNGENDCYDGSDEAPLLCNTTKKVTTPVVTETPLEL 221
            .|..   :.|...::||....|||. :..|:||.||.||||||...|.                 
Zfish   569 RCAKSIAVHCSDSTYKCKNKQCISKLNPMCDGETDCVDGSDEAECKCG----------------- 616

  Fly   222 LGCPLPLGDERPILTGDGSRVLTGPITRGTVRFSCKQGYVLEGEESSYCAKNKWSTSTIPKCVKY 286
                     ::|                      .|...::.|::|.                  
Zfish   617 ---------KKP----------------------HKSSRIVGGKDSD------------------ 632

  Fly   287 CSTAGEFDGYSTKALCTHNGQQVECRKPFHPPGTEVKFVCSTGFKTLSPLPEMRCMKGGYWNRGR 351
                                                                     .|.|    
Zfish   633 ---------------------------------------------------------EGEW---- 636

  Fly   352 QRCEQDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCV 416
                                         ||.|.|::    |.....||.|:::...::||||||
Zfish   637 -----------------------------PWQVSLHM----KTQGHVCGASVISNSWLVTAAHCV 668

  Fly   417 YDEGTRLPYSYDTFRVIAAKFY------RNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLAL 475
            .|.        |.||...|..:      .|.|||:...:|..:|:|. .|.|.  ..:|..|:||
Zfish   669 QDN--------DQFRYSQADQWEVYLGLHNQGETSKSTQRSVLRIIP-HPQYD--HSSYDNDIAL 722

  Fly   476 LTLDEPFELSHVIRPICVTFAS--FAEKESVTDDVQGKFAGW-----------NIENKHELQFVP 527
            :.||.|..|:..|.|||:...:  |...:||.      ..||           ::..|.|::.: 
Zfish   723 MELDSPVTLNQNIWPICLPDPTHYFPAGKSVW------ITGWGKLREGSDAVPSVLQKAEVRII- 780

  Fly   528 AVSKSNSVCRRNLRD-IQADKFC--IFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGV 589
                :::||.:.:.| |.....|  :.:.|.. ||||||||..:        |.....|.||.||
Zfish   781 ----NSTVCSKLMDDGITPHMICAGVLSGGVD-ACQGDSGGPMS--------SIEGNGRMFLAGV 832

  Fly   590 IS 591
            :|
Zfish   833 VS 834

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566 13/26 (50%)
LDLa 70..101 CDD:197566 12/30 (40%)
LDLa 123..157 CDD:197566 14/33 (42%)
LDLa 167..199 CDD:238060 15/32 (47%)
CCP <251..284 CDD:153056 3/32 (9%)
Sushi 309..354 CDD:278512 2/44 (5%)
Tryp_SPc 371..616 CDD:214473 68/243 (28%)
Tryp_SPc 371..591 CDD:304450 67/241 (28%)
st14bXP_005161261.1 SEA 92..180 CDD:279699
CUB 233..342 CDD:238001
CUB 351..457 CDD:238001
LDLa 465..497 CDD:238060 15/31 (48%)
LDLa 499..533 CDD:238060 14/35 (40%)
LDLa 536..570 CDD:238060 17/38 (45%)
LDLa 578..613 CDD:238060 17/34 (50%)
Tryp_SPc 624..858 CDD:214473 72/354 (20%)
Tryp_SPc 625..861 CDD:238113 72/353 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.