DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and Tmprss6

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_082178.2 Gene:Tmprss6 / 71753 MGIID:1919003 Length:811 Species:Mus musculus


Alignment Length:573 Identity:119/573 - (20%)
Similarity:173/573 - (30%) Gaps:259/573 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SCISQYDVCNGEKNCPDGSDETALTCVSQRQHCTKPYFQCTY-GACVIGTAGCNGVNECADGSDE 101
            |..:|.|.|.||                         |.|:. |.||   ..|:|:.:|.:|.||
Mouse   450 SLYNQSDPCPGE-------------------------FLCSVNGLCV---PACDGIKDCPNGLDE 486

  Fly   102 TRLRCGNEDDIRQHDRRLQGNCKENEFKCPSGICLDKSNFLCDGKDDCADGTGFDESVELCGH-M 165
            ....|           |....|:|:      ..|:.... :||.:.||.:|:  ||  |.|.. :
Mouse   487 RNCVC-----------RAMFQCQED------STCISLPR-VCDRQPDCLNGS--DE--EQCQEGV 529

  Fly   166 ECPAYSFKCGTGGCI-SGSLSCNGENDCYDGSDEAPLLCNTTKKVTTPVVTETPLELLGCPLPLG 229
            .|..::|:|....|: ..:..|:|::||.|||||....|.                         
Mouse   530 PCGTFTFQCEDRSCVKKPNPECDGQSDCRDGSDEQHCDCG------------------------- 569

  Fly   230 DERPILTGDGSRVLTGPITRGTVRFSCKQGYVLEGEESSYCAKNKWSTSTIPKCVKYCSTAGEFD 294
                 |.|..||::.|.::.             |||                             
Mouse   570 -----LQGLSSRIVGGTVSS-------------EGE----------------------------- 587

  Fly   295 GYSTKALCTHNGQQVECRKPFHPPGTEVKFVCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCG 359
                                                                |            
Mouse   588 ----------------------------------------------------W------------ 588

  Fly   360 QLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLP 424
                                 ||...|.:    :..|. |||:|:....|||||||..::....|
Mouse   589 ---------------------PWQASLQI----RGRHI-CGGALIADRWVITAAHCFQEDSMASP 627

  Fly   425 YSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIR 489
            ..:..|   ..|..:|  ...|.|....|..:.:.|.::..:.:|  |:|||.||.|...|..:|
Mouse   628 KLWTVF---LGKMRQN--SRWPGEVSFKVSRLFLHPYHEEDSHDY--DVALLQLDHPVVYSATVR 685

  Fly   490 PICVTFAS-FAEKESVTDDVQGK---FAGW----------NIENKHELQFVPAVSKSNSVCRRNL 540
            |:|:...| |.|        .|:   ..||          |...|.::|.||     ..:|....
Mouse   686 PVCLPARSHFFE--------PGQHCWITGWGAQREGGPVSNTLQKVDVQLVP-----QDLCSEAY 737

  Fly   541 R-DIQADKFCI-FTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVIS 591
            | .:.....|. :.:||..||||||||......|        :.|.||.|::|
Mouse   738 RYQVSPRMLCAGYRKGKKDACQGDSGGPLVCREP--------SGRWFLAGLVS 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566 6/19 (32%)
LDLa 70..101 CDD:197566 9/31 (29%)
LDLa 123..157 CDD:197566 8/33 (24%)
LDLa 167..199 CDD:238060 12/32 (38%)
CCP <251..284 CDD:153056 3/32 (9%)
Sushi 309..354 CDD:278512 1/44 (2%)
Tryp_SPc 371..616 CDD:214473 65/237 (27%)
Tryp_SPc 371..591 CDD:304450 64/235 (27%)
Tmprss6NP_082178.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060 13/57 (23%)
LDLa 495..525 CDD:238060 11/40 (28%)
Ldl_recept_a 529..566 CDD:278486 13/36 (36%)
Tryp_SPc 576..806 CDD:214473 71/367 (19%)
Tryp_SPc 577..809 CDD:238113 70/366 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.