DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and C1R

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens


Alignment Length:628 Identity:138/628 - (21%)
Similarity:229/628 - (36%) Gaps:168/628 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 VNECADGSDETRLRCGNEDDIRQHDRRLQGNCKENEF-KCPSGICLDKSNFLCDGKDDCA----- 150
            ::|||     :|.:.| |:|.:...:.|..|.....| .|..|..|.:....|..  :|:     
Human   157 LDECA-----SRSKSG-EEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQA--ECSSELYT 213

  Fly   151 DGTGFDESVEL---------CGH-------------------------MECPAYSFKCGTGGCIS 181
            :.:|:..|:|.         |.:                         :.||....:        
Human   214 EASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPFDIDDHQQVHCPYDQLQ-------- 270

  Fly   182 GSLSCNGEN-DCYDGSDEAPLLCNTTKKVTTPVVTET-----------PLELLGCPLPLG-DERP 233
              :..||:| ..:.|....|.|..::..|.....|:.           ..|::.||.|.. ||..
Human   271 --IYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLRYTTEIIKCPQPKTLDEFT 333

  Fly   234 ILTGDGSRVLTGPITRGTVRF------SCKQGY-VLEGEE-----SSYCAKNKWSTSTIPKC-VK 285
            |:..          .:...:|      :||||| ::||.:     ::.|..:......:|:| :|
Human   334 IIQN----------LQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDDGTWHRAMPRCKIK 388

  Fly   286 YCSTA-----GEFDGYSTKALCTHNGQ-QVECRKPFHPPGTEVKFVCSTGFKTLSPLPEMRCMKG 344
            .|...     |:|...:|..:.|:..: |..|.:|::      |.....|.:. |......|...
Human   389 DCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYY------KMQTRAGSRE-SEQGVYTCTAQ 446

  Fly   345 GYWNRGRQ-----RCEQDCGQLATPIKQFSS--GGYTINNTVVPWHVGLYVWHNEKDYHFQCGGS 402
            |.|...::     ||...||:...|::|...  ||........||.|...:       |.:.||:
Human   447 GIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNI-------HGRGGGA 504

  Fly   403 LLTPDLVITAAHCVY--DEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRR----DVRLIEIAPG 461
            ||....::||||.:|  :...:...|.|.|          .|.|..||..:    .:|.:.:.|.
Human   505 LLGDRWILTAAHTLYPKEHEAQSNASLDVF----------LGHTNVEELMKLGNHPIRRVSVHPD 559

  Fly   462 YK-GRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESVTD-DVQGKFAGWNI-ENK--H 521
            |: ..:.|:..|:|||.|:....|...:.|||:     .:.::..| .:.|..:|:.: |.|  |
Human   560 YRQDESYNFEGDIALLELENSVTLGPNLLPICL-----PDNDTFYDLGLMGYVSGFGVMEEKIAH 619

  Fly   522 ELQFVPAVSKSNSVCRRNLRDIQADKFCIFTQG---------KSLACQGDSGGGFTSELPTNAFS 577
            :|:||.....:...|...||.  .::..:|:|.         |..||||||||.|....|     
Human   620 DLRFVRLPVANPQACENWLRG--KNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDP----- 677

  Fly   578 TWNTARHFLFGVISNAPNADQCAHSLTVMTNIQHFEDMILNAM 620
              ||.|....|::|....   |:......|.:.::.|.|...|
Human   678 --NTDRWVATGIVSWGIG---CSRGYGFYTKVLNYVDWIKKEM 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566 3/8 (38%)
LDLa 123..157 CDD:197566 7/39 (18%)
LDLa 167..199 CDD:238060 6/32 (19%)
CCP <251..284 CDD:153056 11/45 (24%)
Sushi 309..354 CDD:278512 8/49 (16%)
Tryp_SPc 371..616 CDD:214473 68/264 (26%)
Tryp_SPc 371..591 CDD:304450 64/239 (27%)
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114 6/27 (22%)
CUB 207..316 CDD:278839 15/118 (13%)
Sushi 323..385 CDD:306569 16/71 (23%)
Sushi 390..461 CDD:306569 14/77 (18%)
Tryp_SPc 477..711 CDD:214473 68/267 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.