DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and TMPRSS3

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:521 Identity:119/521 - (22%)
Similarity:174/521 - (33%) Gaps:170/521 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 NFLCDGKDDCADGTGFDESVELCGHMECPAYSFKCGTGGCISGSLSCNGENDCYDGSDEAPLLCN 204
            :|.|.||..|..                   |||     ||.....|:|.:||.||.||      
Human    70 HFDCSGKYRCRS-------------------SFK-----CIELIARCDGVSDCKDGEDE------ 104

  Fly   205 TTKKVTTPVVTETPLELLGCPLPLGDERPILTGDGSRVLTGPITRGTVRFSCKQGYVLEGEESSY 269
                                      .|.:..| |...:....|..:.:..|...:  :|..::.
Human   105 --------------------------YRCVRVG-GQNAVLQVFTAASWKTMCSDDW--KGHYANV 140

  Fly   270 -CAKNKWSTSTIPKCVKYCSTAGEFDGY---------STKALCTHNGQQVECRKPFHPPGTEVKF 324
             ||:..:.:......::..|..|:|...         ..|....|:             ...|:.
Human   141 ACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHH-------------SVYVRE 192

  Fly   325 VCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATPIKQFSS---GGYTINNTVVPWHVGL 386
            .|::|.     :..::|...|: .||                 :||   ||.....:..||...|
Human   193 GCASGH-----VVTLQCTACGH-RRG-----------------YSSRIVGGNMSLLSQWPWQASL 234

  Fly   387 YVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRR 451
            ..    :.||. ||||::||..:|||||||||  ..||.|: |.:|.......|...:...||  
Human   235 QF----QGYHL-CGGSVITPLWIITAAHCVYD--LYLPKSW-TIQVGLVSLLDNPAPSHLVEK-- 289

  Fly   452 DVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKF---A 513
                  |....|.:.:....|:||:.|..|...:.:|:|:|:.    ..:|:..|   ||.   :
Human   290 ------IVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLP----NSEENFPD---GKVCWTS 341

  Fly   514 GWNIEN----------KHELQFVPAVSKSNSVCRRNLRD-----IQADKFCI-FTQGKSLACQGD 562
            ||....          .|..  ||.:  ||.:|  |.||     |.....|. :..|...:||||
Human   342 GWGATEDGAGDASPVLNHAA--VPLI--SNKIC--NHRDVYGGIISPSMLCAGYLTGGVDSCQGD 400

  Fly   563 SGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCA--HSLTVMTNIQHFEDMILNAMNRSVE 625
            |||    .|.......|.......||:        .||  :...|.|.:..|.|.|...|.|.::
Human   401 SGG----PLVCQERRLWKLVGATSFGI--------GCAEVNKPGVYTRVTSFLDWIHEQMERDLK 453

  Fly   626 T 626
            |
Human   454 T 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566 5/16 (31%)
LDLa 167..199 CDD:238060 12/31 (39%)
CCP <251..284 CDD:153056 4/33 (12%)
Sushi 309..354 CDD:278512 7/44 (16%)
Tryp_SPc 371..616 CDD:214473 75/265 (28%)
Tryp_SPc 371..591 CDD:304450 69/238 (29%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060 16/88 (18%)
SRCR_2 112..210 CDD:292133 16/118 (14%)
Tryp_SPc 216..444 CDD:214473 75/268 (28%)
Tryp_SPc 217..447 CDD:238113 76/270 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.