Sequence 1: | NP_536776.2 | Gene: | modSP / 42032 | FlyBaseID: | FBgn0051217 | Length: | 628 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097175.2 | Gene: | CG34171 / 5740474 | FlyBaseID: | FBgn0085200 | Length: | 292 | Species: | Drosophila melanogaster |
Alignment Length: | 198 | Identity: | 45/198 - (22%) |
---|---|---|---|
Similarity: | 76/198 - (38%) | Gaps: | 44/198 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 390 HNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKR--RD 452
Fly 453 VRLIEIAPGYKGRTENYYQDLALLTLDEPFEL-SHVIRPICVTFASFAEKESVTDDVQ------- 509
Fly 510 ------GKFAGWNIENKHELQFVPAVSKSNSVCRRNLRDIQA------DKFCIFTQGKSLACQGD 562
Fly 563 SGG 565 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
modSP | NP_536776.2 | LDLa | 27..58 | CDD:197566 | |
LDLa | 70..101 | CDD:197566 | |||
LDLa | 123..157 | CDD:197566 | |||
LDLa | 167..199 | CDD:238060 | |||
CCP | <251..284 | CDD:153056 | |||
Sushi | 309..354 | CDD:278512 | |||
Tryp_SPc | 371..616 | CDD:214473 | 45/198 (23%) | ||
Tryp_SPc | 371..591 | CDD:304450 | 45/198 (23%) | ||
CG34171 | NP_001097175.2 | Trypsin | 29..260 | CDD:278516 | 45/198 (23%) |
Tryp_SPc | 38..263 | CDD:304450 | 45/198 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45436938 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |