DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and ldlrad3

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001124079.1 Gene:ldlrad3 / 570705 ZFINID:ZDB-GENE-030131-1533 Length:314 Species:Danio rerio


Alignment Length:193 Identity:52/193 - (26%)
Similarity:68/193 - (35%) Gaps:69/193 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FECDNGSCISQYDVCNGEKNCPDGSDETALTCVSQRQHCTKPYFQCTYGA-CVIGTAGCNGVNEC 95
            |.|.:|.|:.....|:|..:|.|.|||..  |:..:..|...:|.|..|. |:||...|||..:|
Zfish    33 FMCADGECVPAAGQCDGYPDCADRSDERG--C
LKLKSKCASTFFSCANGVHCIIGRFQCNGFRDC 95

  Fly    96 ADGSDETRLRCGNEDDIRQHDRRLQGNCKENEFKCPSGICLDKSNFLCDGKDDCADGTGFDESVE 160
            .|||||                   .||..:...|.|                            
Zfish    96 PDGSDE-------------------DNCTAHPLLCSS---------------------------- 113

  Fly   161 LCGHMECPAYSFKCGTGGCISGSLSCNGENDCYDGSDEAPLLCNTTKKVTTPVVTETPLELLG 223
                     ..|.|..|.|:..|..|||:::|.|.|||..  |.||        .|:|..:||
Zfish   114 ---------LRFHCANGRCVDRSFLCNGQDNCQDNSDEEN--CLTT--------AESPEHMLG 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566 9/25 (36%)
LDLa 70..101 CDD:197566 14/31 (45%)
LDLa 123..157 CDD:197566 3/33 (9%)
LDLa 167..199 CDD:238060 12/31 (39%)
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473
Tryp_SPc 371..591 CDD:304450
ldlrad3NP_001124079.1 LDLa 30..62 CDD:238060 11/30 (37%)
LDLa 69..104 CDD:238060 16/53 (30%)
LDLa 111..145 CDD:238060 15/72 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.