DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and PROC

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:633 Identity:137/633 - (21%)
Similarity:210/633 - (33%) Gaps:225/633 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CTYGACVIGTAGCNGVNECADGSDETRLRCGNEDDIRQ-HDRRLQ----GNCKENEFKC---PSG 133
            |.||  :..|.||:|               |...:::. ||..||    ..|..::..|   |.|
Human    60 CGYG--LTRTPGCHG---------------GRTANLQYLHDPPLQVPVPPECGSSQASCCSWPPG 107

  Fly   134 -------------------------------ICLDKSNFLCDGKDDCADGTGFDESVELCGH--- 164
                                           .|:::   :||          |:|:.|:..:   
Human   108 EFPAHQLLLVLRIRKRANSFLEELRHSSLERECIEE---ICD----------FEEAKEIFQNVDD 159

  Fly   165 ------------------MECPAYSFKCGTGGCIS--GSLSCNGENDCYDGSDEAPLLCNTTKKV 209
                              :|.|..|..||.|.||.  ||.||    ||..|.:..  .|...:  
Human   160 TLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC----DCRSGWEGR--FCQRGE-- 216

  Fly   210 TTPVVTETPLELLGCPLPLGDERPILTGDGSRVLTGP-ITRGTVRFSCKQGYVLEGEESSYCAKN 273
                                .||.:|.|.|:.:  || ..|||               |:.|.: 
Human   217 --------------------GERWMLAGGGAGL--GPGWGRGT---------------STSCPR- 243

  Fly   274 KWSTSTIPKCVKYCSTAGEFDGYSTKALCTHNG-QQVECRKPFHPPGTE-----------VKFVC 326
                ..:|..|.:.:.:.:..|      |||.. ::|..|:....||.:           |||.|
Human   244 ----PPLPAEVSFLNCSLDNGG------CTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPC 298

  Fly   327 STGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHN 391
            ...:|.:              .:.|...::|.......:......|........||.|.|.    
Human   299 GRPWKRM--------------EKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLL---- 345

  Fly   392 EKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPY---SYDTFRVIAAKFYRNYGETTPEEKRRDV 453
            :......||..|:.|..|:|||||: ||..:|..   .||..|      :..:      |...|:
Human   346 DSKKKLACGAVLIHPSWVLTAAHCM-DESKKLLVRLGEYDLRR------WEKW------ELDLDI 397

  Fly   454 RLIEIAPGY-KGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNI 517
            :.:.:.|.| |..|:|   |:|||.|.:|..||..|.|||:..:..||:|......:....||..
Human   398 KEVFVHPNYSKSTTDN---DIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGY 459

  Fly   518 ENKHE----------LQFVPAVSKSNSVCRRNLRD-IQADKFCIFTQG-KSLACQGDSGGGFTSE 570
            .:..|          |.|:......::.|...:.: :..:..|....| :..||:|||||...:.
Human   460 HSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVAS 524

  Fly   571 LPTNAFSTWNTARHFLFGVISNAPNADQCA--HSLTVMTNIQHFEDMI 616
            .    ..||     ||.|::|   ..:.|.  |:..|.|.:..:.|.|
Human   525 F----HGTW-----FLVGLVS---WGEGCGLLHNYGVYTKVSRYLDWI 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566 7/23 (30%)
LDLa 123..157 CDD:197566 8/67 (12%)
LDLa 167..199 CDD:238060 14/33 (42%)
CCP <251..284 CDD:153056 4/32 (13%)
Sushi 309..354 CDD:278512 10/55 (18%)
Tryp_SPc 371..616 CDD:214473 69/262 (26%)
Tryp_SPc 371..591 CDD:304450 63/235 (27%)
PROCXP_024308770.1 GLA 117..168 CDD:214503 6/63 (10%)
EGF_CA 182..213 CDD:238011 13/36 (36%)
FXa_inhibition 255..290 CDD:317114 8/40 (20%)
Tryp_SPc 328..563 CDD:238113 70/265 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.