Sequence 1: | NP_536776.2 | Gene: | modSP / 42032 | FlyBaseID: | FBgn0051217 | Length: | 628 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001919970.5 | Gene: | sez6a / 562079 | ZFINID: | ZDB-GENE-030131-8208 | Length: | 981 | Species: | Danio rerio |
Alignment Length: | 589 | Identity: | 101/589 - (17%) |
---|---|---|---|
Similarity: | 152/589 - (25%) | Gaps: | 289/589 - (49%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 LLLKFRTIFAACDSSQFECDNG---------------SCISQYDVCNGEKNCPDGSDETALTCVS 65
Fly 66 QRQHCTKPYFQCTYGACVIGTAG------------------------CNGVNECADG-------- 98
Fly 99 -----SDETRLRCGNEDDI----------------------RQH--------------------D 116
Fly 117 RRLQGNCKEN--------------------EFKCPSGI----------CLDKSN----------- 140
Fly 141 FLCDGKDDCADGTGFDESVELCGHMECPAYSFKCGTG-GCISG-------------SLSCNGEND 191
Fly 192 ---CYDGSD-------------------------------------------------------- 197
Fly 198 --EAPLLCNTTKKVTTPVVTETPL--------------ELLGCPLPL---GD----------ERP 233
Fly 234 ILTGDGSRVLTGP--ITRGTVRFSCKQGYVLEGEESSYC-----AKNKWSTSTIPKCV--KY--C 287
Fly 288 STAGEFDGYSTKALCTHNGQQVECRKPFHPPGTEVKFVCSTGFKTLSPLPEMRCMKG--GYWNRG 350
Fly 351 RQRC 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
modSP | NP_536776.2 | LDLa | 27..58 | CDD:197566 | 8/45 (18%) |
LDLa | 70..101 | CDD:197566 | 8/67 (12%) | ||
LDLa | 123..157 | CDD:197566 | 10/74 (14%) | ||
LDLa | 167..199 | CDD:238060 | 12/106 (11%) | ||
CCP | <251..284 | CDD:153056 | 12/37 (32%) | ||
Sushi | 309..354 | CDD:278512 | 10/46 (22%) | ||
Tryp_SPc | 371..616 | CDD:214473 | |||
Tryp_SPc | 371..591 | CDD:304450 | |||
sez6a | XP_001919970.5 | CUB | 230..335 | CDD:294042 | 2/5 (40%) |
CCP | 340..395 | CDD:214478 | 14/69 (20%) | ||
CUB | 399..509 | CDD:238001 | 10/109 (9%) | ||
Sushi | 515..572 | CDD:278512 | 8/56 (14%) | ||
CUB | 576..685 | CDD:238001 | 16/119 (13%) | ||
CCP | 693..749 | CDD:153056 | 12/55 (22%) | ||
CCP | 754..814 | CDD:153056 | 17/60 (28%) | ||
CCP | 821..879 | CDD:153056 | 15/70 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |