DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and Jon99Fii

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:266 Identity:61/266 - (22%)
Similarity:86/266 - (32%) Gaps:93/266 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 TLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATPIKQFS-----SGGYTINNTVVPWHVGLYVWHN 391
            |..|.||.:.                   :.||:|...     :.||......||:.|||....|
  Fly    15 TAIPTPEQKL-------------------VPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGN 60

  Fly   392 EKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLI 456
            .   ::.||||::....|:|||||...               |:....|||.:...:        
  Fly    61 G---NWWCGGSIIGNTWVLTAAHCTNG---------------ASGVTINYGASLRNQ-------- 99

  Fly   457 EIAPGYKG-------------RTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDV 508
               |.|..             .:.|.:.|::|:.... .:..|::..:        |..|..|..
  Fly   100 ---PQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPH-VDFWHLVNKV--------ELPSYNDRY 152

  Fly   509 QGKFAGW------------NIENKHELQFVPAVSKSNSVCRR--NLRDIQADKFCIFTQGKSLAC 559
            | .:|||            .......||.|.....|.|.|.|  :|.|   :..||.|.|....|
  Fly   153 Q-DYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRSWSLHD---NMICINTNGGKSTC 213

  Fly   560 QGDSGG 565
            .|||||
  Fly   214 GGDSGG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 4/21 (19%)
Tryp_SPc 371..616 CDD:214473 54/222 (24%)
Tryp_SPc 371..591 CDD:304450 54/222 (24%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 54/225 (24%)
Tryp_SPc 38..262 CDD:238113 54/224 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436818
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.