DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG11842

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:243 Identity:59/243 - (24%)
Similarity:86/243 - (35%) Gaps:86/243 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 GQLATPIKQFSSG---GYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYD-E 419
            |..|.| |:|...   |:...|..|.|.               |||:|::...|:|||||.|. :
  Fly    76 GGPAVP-KEFPHAARLGHKDENGEVEWF---------------CGGTLISDRHVLTAAHCHYSPQ 124

  Fly   420 GTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENY---YQDLALLTLDEP 481
            |     |.:..|:...:|..|..:..||:  .||:.....|.:     :|   |.|::::.|..|
  Fly   125 G-----SVNIARLGDLEFDTNNDDADPED--FDVKDFTAHPEF-----SYPAIYNDISVVRLSRP 177

  Fly   482 FELSHVIRPICVTFASFAEKESVTDDVQGKFA------GWNIENKHELQFVPAVSKS-------- 532
            ...:....|.|:.|          ||  |:..      ||.     :|:.||.....        
  Fly   178 VTFNDYKHPACLPF----------DD--GRLGTSFIAIGWG-----QLEIVPRTENKKLQKVKLY 225

  Fly   533 --NSVCRRNLRDIQADK-------------FCIFTQGKSLACQGDSGG 565
              .:.||     |.||:             .||.:......|.|||||
  Fly   226 NYGTRCR-----ITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 54/231 (23%)
Tryp_SPc 371..591 CDD:304450 54/231 (23%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 59/243 (24%)
Tryp_SPc 73..312 CDD:214473 59/243 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.