DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and SPE

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:277 Identity:69/277 - (24%)
Similarity:99/277 - (35%) Gaps:77/277 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 CGQLATPIKQFSSGGYTINNTVV---PWHVGL-YVWHNEKDYHFQCGGSLLTPDLVITAAHCV-- 416
            ||.|      |:...:...||.:   ||.|.| |.....:.|.|.|||:||....|:||.||:  
  Fly   127 CGFL------FADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLAS 185

  Fly   417 --YDEGTRLPYS-----YDTFRVIAAKFYRNYGETTPE------------EKRRDVRLIEIAPG- 461
              .|:...:.:|     :||             .|.|:            .|..|   ||:..| 
  Fly   186 RELDKSGAVLHSVRLGEWDT-------------RTDPDCTTQMNGQRICAPKHID---IEVEKGI 234

  Fly   462 ----YKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNI-ENKH 521
                |...:.:...|:||:.|......:..:||||:......:...|  |.....|||.: ||..
  Fly   235 IHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFV--DYGMDVAGWGLTENMQ 297

  Fly   522 ELQFVPAVSKSNSVCRRNLRDIQADKFCIF---------TQGKSL---ACQGDSGGGFTSELPTN 574
            .    .|:....:|...||...| :|:..|         ..|..|   .|.|||||.....:.|.
  Fly   298 P----SAIKLKITVNVWNLTSCQ-EKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTG 357

  Fly   575 AFSTWNTARHFLFGVIS 591
            ....:     ::.||.|
  Fly   358 GRDVF-----YIAGVTS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 65/264 (25%)
Tryp_SPc 371..591 CDD:304450 64/262 (24%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 65/263 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437261
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.