DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG16710

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:405 Identity:95/405 - (23%)
Similarity:137/405 - (33%) Gaps:102/405 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 VLEGEESSYCAKNKWSTSTI-PKCVKY--CSTAGEFDGYSTKALCTHNGQQVE--------CRKP 314
            ||..:...|.|::::....: .||:..  |::...|       |..||....|        |  .
  Fly    13 VLHTQLLMYLAESEYPPCNLDEKCISLARCTSLLPF-------LKPHNMTPAEKAVFEDRYC--G 68

  Fly   315 FHPPGTEV---KFVCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATPIKQFSSGGYTIN 376
            :.|.|.|:   ..:|......:.|..::                  ||.:....:.|  ||....
  Fly    69 YGPKGQELLDRVLICCPNMGHILPNTQI------------------CGPIMPAYRIF--GGEETQ 113

  Fly   377 NTVVPW-------HVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIA 434
            ...:||       |....|| ||: ...:|.|||:|...|:|||||:...|      .|..||  
  Fly   114 PNELPWMALILYAHRSRSVW-NER-LVSRCAGSLITNRYVLTAAHCLRITG------LDLRRV-- 168

  Fly   435 AKFYRNYGE------------------TTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEP 481
                 ..||                  ..||....||.|......|....|..|.|:|||.|..|
  Fly   169 -----RLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFP 228

  Fly   482 FELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNIENKHELQFVPAVSKSN----SVCRRNLRD 542
            ...:..|:||||.........|.::. :.:.|||.:.:|.....|...:..|    ..|..:...
  Fly   229 VRYTAQIKPICVQLDYIFSNPSFSNH-KLQIAGWGLSHKQGYSNVLLQAYVNGRNADECSLSEPS 292

  Fly   543 IQADK---FCIFTQGKSLACQGDSGGGFTS--ELPTNAFSTWNTARHFLFGVISNAPNADQCAHS 602
            :..||   .|....|.:..|:|||||...:  |.....|.       :|.|:.|.  ...||.:.
  Fly   293 LGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFV-------YLAGITSY--GYSQCGYG 348

  Fly   603 LTVMTNIQHFEDMIL 617
            ....|....|.:.||
  Fly   349 PAAYTKTSKFVEWIL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056 5/23 (22%)
Sushi 309..354 CDD:278512 7/55 (13%)
Tryp_SPc 371..616 CDD:214473 72/278 (26%)
Tryp_SPc 371..591 CDD:304450 67/253 (26%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 12/57 (21%)
Tryp_SPc 105..362 CDD:214473 73/283 (26%)
Tryp_SPc 106..362 CDD:238113 73/282 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437225
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.