DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG31219

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:343 Identity:78/343 - (22%)
Similarity:112/343 - (32%) Gaps:135/343 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 GQQVECRKPFHPPGTEVKFVCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATPIKQFSS 370
            ||::.|    .|||..:            |..|:                  |||..:..:..  
  Fly    62 GQRICC----PPPGNRL------------PSTEI------------------CGQSLSTYRMV-- 90

  Fly   371 GGYTINNTVVPWHVGLYVWHNEKDYHFQ--CGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVI 433
            ||........|| :.:.::.|.......  |.|||:....|:|:||||    ..:|      |.:
  Fly    91 GGSEARPNGYPW-MAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCV----NGIP------RDL 144

  Fly   434 AAKFYRNYGE--------TTPEEKRRD---------VRLIEIA-----PGYKGRTENYYQDLALL 476
            :.|..| .||        ..|:.:.:|         ::|.:|.     .....|...|  |:|||
  Fly   145 SLKSVR-LGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEY--DIALL 206

  Fly   477 TLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNIENKHELQFVPAV------SKSNSV 535
            .|..|......|.|||:....|..|..:      :.|||...|  |.||...:      .:|.:|
  Fly   207 RLKMPVRYRTGIMPICIPKHGFFAKSKL------EIAGWGKTN--EGQFSQVLMHGFIRERSIAV 263

  Fly   536 CRRNLRDIQADKFCIFTQGKSL-----------ACQGDSGG--------------GFTS------ 569
            |        |.:|......:||           .|||||||              |.|:      
  Fly   264 C--------ALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNC 320

  Fly   570 ---ELP-----TNAFSTW 579
               .:|     |:||..|
  Fly   321 GQIGIPGIYTRTSAFLPW 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 6/44 (14%)
Tryp_SPc 371..616 CDD:214473 67/278 (24%)
Tryp_SPc 371..591 CDD:304450 67/278 (24%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 67/283 (24%)
Tryp_SPc 90..342 CDD:238113 67/281 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.