DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG9649

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:348 Identity:89/348 - (25%)
Similarity:128/348 - (36%) Gaps:95/348 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 QVECRKPFHPPGTEVKFVCSTGF--KTLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATPIKQFSS 370
            |...|...||..|..:   ::.|  :|:..|..: |        ||::..|      ||   |..
  Fly   215 QTSARPSVHPSNTPAQ---ASKFYPQTIGQLSGI-C--------GREKVIQ------TP---FIH 258

  Fly   371 GGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAA 435
            .|..:....:||...|:. |..:||:|.|||:|::...||:||||.......||           
  Fly   259 NGIEVERGQLPWMAALFE-HVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLP----------- 311

  Fly   436 KFYRNYGETTPEEKRRD-------------VRLIEIAPGYKGRTENYY--QDLALLTLDEPFELS 485
                  ||.|.....|:             .||: |...|   ..|.|  .|||||.|....::.
  Fly   312 ------GERTIVSLGRNSLDLFSSGATLGVARLL-IHEQY---NPNVYTDADLALLQLSNHVDIG 366

  Fly   486 HVIRPICVTFASF------AEKESVTDDVQGKFAGWNIENKHELQFVPAVSKSNSV-----CRRN 539
            ..|:|||:...:|      ..|..|        |||..:.|.......|......:     ||.|
  Fly   367 DYIKPICLWNENFLLELPSGHKSYV--------AGWGEDEKGNRNTRLAKMTDTDIITQWECRGN 423

  Fly   540 LRD-----IQADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPN-ADQ 598
            |.:     |.:...|......|..|.||||||    |.......|     .|.||:|.... .::
  Fly   424 LSEENAKFITSHTICASNAQASGPCSGDSGGG----LMLQEQDIW-----MLRGVVSAGQRMTNR 479

  Fly   599 CAHSLTVM-TNIQHFEDMILNAM 620
            |..:|.|: |::....:.:|::|
  Fly   480 CNLTLPVIYTDVAKHIEWLLSSM 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 10/46 (22%)
Tryp_SPc 371..616 CDD:214473 72/277 (26%)
Tryp_SPc 371..591 CDD:304450 67/250 (27%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 72/279 (26%)
Tryp_SPc 259..497 CDD:214473 72/276 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.