DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and snk

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:469 Identity:117/469 - (24%)
Similarity:174/469 - (37%) Gaps:119/469 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 DEAPLLCNTTKKVTTPVV-TETPLELLGCPL---PLGDERPILT-GDGSRVLTGPITRGTVRFSC 256
            |...::...|.|.|.|.| .|.|:..:|..:   ...||...|. ||.:.|.|.           
  Fly    29 DALEIINYQTTKYTIPEVWKEQPVATIGEDVDDQDTEDEESYLKFGDDAEVRTS----------- 82

  Fly   257 KQGYVLEG-EESSYCAKNKWSTSTIPKCVKYCSTA-------GEFDGYSTKA-LCTH-NGQQVEC 311
                |.|| .|.::|.::....|      .||..|       .|:..:.|:. :||| |...|.|
  Fly    83 ----VSEGLHEGAFCRRSFDGRS------GYCILAYQCLHVIREYRVHGTRIDICTHRNNVPVIC 137

  Fly   312 RKPFHPPGTEVKFVCSTGFKTL--SPLPEMRCMKGGYWNRGRQRCEQD------CGQLATPIKQF 368
                          |....|.:  ..:...:|.:   :|...:|....      .|:...|....
  Fly   138 --------------CPLADKHVLAQRISATKCQE---YNAAARRLHLTDTGRTFSGKQCVPSVPL 185

  Fly   369 SSGGYTINNTVVPWHVGLYVW-----HNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYD 428
            ..||....:.:.| |:....|     ..::|..:.|||:|::...|:|||||. ..|::.|   |
  Fly   186 IVGGTPTRHGLFP-HMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCA-TSGSKPP---D 245

  Fly   429 TFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICV 493
            ..|:.|    |...||:..::...:.:|.:.|.|  |:..||.|:|||.|....:.|..:||.|:
  Fly   246 MVRLGA----RQLNETSATQQDIKILIIVLHPKY--RSSAYYHDIALLKLTRRVKFSEQVRPACL 304

  Fly   494 TFASFAEKESVTDDVQGKFAGW----------NIENKHELQFVPAVSKSNSVC-------RRNLR 541
            ......:..:|.      .|||          |...:.:|..||.::     |       ||..|
  Fly   305 WQLPELQIPTVV------AAGWGRTEFLGAKSNALRQVDLDVVPQMT-----CKQIYRKERRLPR 358

  Fly   542 DIQADKFCI-FTQGKSLACQGDSGGGFTSELPTN---AFSTWNTARHFLFGVISNAPNADQCAHS 602
            .|...:||. :..|....|||||||...:.||..   ||....|:    ||....||||.     
  Fly   359 GIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITS----FGKFCAAPNAP----- 414

  Fly   603 LTVMTNIQHFEDMI 616
             .|.|.:..:.|.|
  Fly   415 -GVYTRLYSYLDWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060 1/1 (100%)
CCP <251..284 CDD:153056 6/33 (18%)
Sushi 309..354 CDD:278512 6/46 (13%)
Tryp_SPc 371..616 CDD:214473 76/270 (28%)
Tryp_SPc 371..591 CDD:304450 69/245 (28%)
snkNP_001097766.1 CLIP 93..139 CDD:197829 13/65 (20%)
Tryp_SPc 186..430 CDD:238113 77/274 (28%)
Tryp_SPc 186..427 CDD:214473 76/272 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.