DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG13318

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:365 Identity:81/365 - (22%)
Similarity:121/365 - (33%) Gaps:117/365 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 SSYCAKNKWSTSTIP--KCVKYCSTA-----GEFD-------GYSTKALCTHNGQQVECRKPFHP 317
            :|||       ..:|  .|.....||     |:.|       ||.|                  .
  Fly    88 TSYC-------QCVPPGSCANPLPTAPSDGSGQIDIRIVNNGGYPT------------------V 127

  Fly   318 PGTEVKFVCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATPIKQFSSGGYTINNTVVPW 382
            |.|.....||.|.        :.|.:.|.:..|| |.....|.......|.|.|.|       ||
  Fly   128 PTTSSTLTCSYGL--------VACCQAGSYQCGR-RFPPPPGSTTAAPGQASFGAY-------PW 176

  Fly   383 HVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPE 447
            ...|.   ...|.:.. ||:|:|...|:||||.||:.|  |.|    |:|...::  :...|:..
  Fly   177 QAALL---TTADVYLG-GGALITAQHVLTAAHKVYNLG--LTY----FKVRLGEW--DAASTSEP 229

  Fly   448 EKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELS--HVIRPICVTFASFAEKESVTDDVQG 510
            ...:||.:..:.........|...|:|:|.|..|..|:  ..:..:|:...||..:....     
  Fly   230 IPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPTTSFVGQRCWV----- 289

  Fly   511 KFAGWN------------IENKHELQFVPAVSKSNSVCRRNLRDIQADK------------FCIF 551
              |||.            ||.:.::..:|     |:.|:..|   ||.:            .|..
  Fly   290 --AGWGKNDFGATGAYQAIERQVDVPLIP-----NANCQAAL---QATRLGSSFVLSPTSFICAG 344

  Fly   552 TQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVIS 591
            .:....||.||.|    |.|...:...|     ::.|:::
  Fly   345 GEAGKDACTGDGG----SPLVCTSNGVW-----YVVGLVA 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056 4/18 (22%)
Sushi 309..354 CDD:278512 9/44 (20%)
Tryp_SPc 371..616 CDD:214473 56/247 (23%)
Tryp_SPc 371..591 CDD:304450 56/245 (23%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 57/250 (23%)
Tryp_SPc 169..399 CDD:214473 57/250 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.