DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and Tmprss11c

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:276 Identity:72/276 - (26%)
Similarity:108/276 - (39%) Gaps:55/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 CG-QLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGT 421
            || :..||.....:||........||...|    .:.:.| :||.:|::...:||||||......
  Rat   175 CGRRTITPGGHKVAGGQDAEEGEWPWQASL----QQNNVH-RCGATLISNSWLITAAHCFVRSAN 234

  Fly   422 RLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSH 486
            ...:.. :|..:.:|          .:.:|.|:.|.|...|.....|  .|:|::.|..|....:
  Rat   235 PKDWKV-SFGFLLSK----------PQAQRAVKSIVIHENYSYPAHN--NDIAVVRLSSPVLYEN 286

  Fly   487 VIRPICVTFASFAEKESVTDDVQGKFAGW----------NIENKHELQFVPAVSKSNSVCRRNLR 541
            .||..|:..|:  :|.....||  ...||          ||..|..::.:     .|..|.....
  Rat   287 NIRRACLPEAT--QKFPPNSDV--VVTGWGTLKSDGDSPNILQKGRVKII-----DNKTCNSGKA 342

  Fly   542 ---DIQADKFCI-FTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCA-- 600
               .|.....|. |.:|:..||||||||...||   ::...|     ||.|::|   ..|:||  
  Rat   343 YGGVITPGMLCAGFLEGRVDACQGDSGGPLVSE---DSKGIW-----FLAGIVS---WGDECALP 396

  Fly   601 HSLTVMTNIQHFEDMI 616
            :...|.|.:.|:.|.|
  Rat   397 NKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 67/260 (26%)
Tryp_SPc 371..591 CDD:304450 59/233 (25%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 67/263 (25%)
Tryp_SPc 187..415 CDD:238113 68/264 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.