DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG14088

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:270 Identity:58/270 - (21%)
Similarity:99/270 - (36%) Gaps:83/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 VVPWHVGLYVWHNEKDYHFQCG-----GSLLTPDLVITAAHC------------VYDE-GTRLPY 425
            |.||...|        :||  |     |:|:....::|..||            .|.. |:.|..
  Fly    43 VGPWTAIL--------HHF--GRIVGVGTLIHERFILTDVHCGDSIGVIRARLGEYGRIGSELAE 97

  Fly   426 SYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRP 490
            .:     |.|.|:.| ....||.:..::.|:::.     ||..|.:              |:| |
  Fly    98 DH-----IVAAFFSN-ANFNPETQANNMGLMKLL-----RTVVYKE--------------HII-P 136

  Fly   491 ICVTFASFAEKESVTDDVQGKFAG--WNIENKHELQFVPAVSKSNSVCRRNLRDIQADKFCIFTQ 553
            :|:...|  ..::..|::. .|.|  |...:|..:.....|.:....|.:    :...:||  ..
  Fly   137 VCILMDS--RMQTFADELD-YFNGTTWKNSDKSPMLRSKTVIRMPQACGK----LDHGQFC--AG 192

  Fly   554 GKSL-ACQGDSGGGFTSEL----PTNAFSTWNTARHFLFGVISNAPNADQCAHSLTV--MTNIQH 611
            .|.| :|...||...|.|:    |.         |..||| |:|:... :|::|.|.  :..:..
  Fly   193 HKDLDSCDEPSGAALTREIDYIGPN---------RTVLFG-IANSVEV-KCSNSRTYTDVVQLHQ 246

  Fly   612 FEDMILNAMN 621
            :..|::.:.|
  Fly   247 WISMVIYSSN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 56/263 (21%)
Tryp_SPc 371..591 CDD:304450 51/236 (22%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 56/263 (21%)
Tryp_SPc 42..248 CDD:214473 56/260 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.