DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and Jon74E

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:255 Identity:68/255 - (26%)
Similarity:99/255 - (38%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 SGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIA 434
            :||........|:.|||.: ....|.:..||.||::...::||||||........|.....|:..
  Fly    33 AGGELARANQFPYQVGLSI-EEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAP 96

  Fly   435 AKFYRNYGETTPEEKRRDVRLIEIAPGYKGRT-ENYYQDLALLTLDEPFELSHVIRPICVTFASF 498
            .:..|:   |.||        :.:.|.:..:: ||   |:||:.|.|...|...||||  .....
  Fly    97 RQLIRS---TNPE--------VHLHPDWNCQSLEN---DIALVRLPEDALLCDSIRPI--RLPGL 145

  Fly   499 AEKESVTDDVQGKFAGWNIEN------KHELQFVPAVSKSNSVCRRNLRDIQADKFCIFTQGKSL 557
            :...:..|.|....:||...|      ...|::|....:||..|..:..:|:....|:.|.|...
  Fly   146 SSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKS 210

  Fly   558 ACQGDSGGGFTSELPT-NAFSTWNTARHFLFGVISNAPNADQCAHSLTVMTNIQHFEDMI 616
            .|.|||||......|. ||        ..|.||.|....:.......:|.|.|..:.|.|
  Fly   211 TCTGDSGGPLVYSDPVQNA--------DILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 67/252 (27%)
Tryp_SPc 371..591 CDD:304450 62/227 (27%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/253 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.