DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG3088

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:218 Identity:44/218 - (20%)
Similarity:68/218 - (31%) Gaps:65/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 PWHVGL-----YVWHNEKDYHFQCGGSLLTPDLVITAAHC--------VYDEGTRLPYSYDTFRV 432
            |:.||:     .:|         |.|:::....::|:|.|        :|...|||..:..|..|
  Fly    41 PYVVGMAFGQSNIW---------CSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTV 96

  Fly   433 IAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFAS 497
            ..:::.                           |.|  |.|||:.:......:.|.|   |...|
  Fly    97 GTSEYV---------------------------TGN--QHLALVRVPRVGFSNRVNR---VALPS 129

  Fly   498 FAEKESVTDDVQGKFAGWNIEN-----KHELQFVPAVSKSNSVCRR--NLRDIQADKFCIFTQGK 555
            ...:....::......||.:..     ...||.|.....||:.|..  ....:.....|..|...
  Fly   130 LRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSG 194

  Fly   556 SLACQGDSGGGFTSELPTNAFST 578
            ...|.||:|    |.|.|...||
  Fly   195 RSTCFGDAG----SPLITKQDST 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 44/218 (20%)
Tryp_SPc 371..591 CDD:304450 44/218 (20%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 44/218 (20%)
Tryp_SPc 29..244 CDD:214473 44/218 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.