DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG33460

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:268 Identity:64/268 - (23%)
Similarity:108/268 - (40%) Gaps:60/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 QDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEG 420
            :.||.:.   ::||:       ::.||...|:.     |....|.|:|:|...::|||.|:..  
  Fly    29 EQCGLMR---EEFST-------SLGPWTALLHT-----DGSIFCAGTLITDVFILTAASCIRP-- 76

  Fly   421 TRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYK-GRTENYYQDLALLTLDEPFEL 484
                   :..:|...:|.| |....||:     .|:.....|: ...|:...::.||.|.:..::
  Fly    77 -------NAVKVRLGEFGR-YPNELPED-----HLVHYFLMYRLFNNESLANNIGLLKLTKRVQI 128

  Fly   485 SHVIRPICVTFASFAEKESVTDDVQGKFAG--W----NIENKHELQFVPAVSKSNSVCRRNLRDI 543
            :..|.|:|:......::.|..     :|.|  |    |:....||:  |.|.:|......|| |:
  Fly   129 TDYIMPVCIVLNPQNQQLSTM-----RFIGNAWMEDSNVSLTKELR--PIVIQSKPKMCTNL-DL 185

  Fly   544 QADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCAHSLTVMTN 608
            .. :||...||...:|.|.:|    |.|..|: ...|..||..||:.:  .|...|..|      
  Fly   186 YT-QFCAGHQGNLRSCDGLTG----SALIQNS-RYMNKYRHIQFGIAT--VNDMDCEES------ 236

  Fly   609 IQHFEDMI 616
             |.:.|::
  Fly   237 -QGYTDVL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 60/251 (24%)
Tryp_SPc 371..591 CDD:304450 55/226 (24%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 60/243 (25%)
Tryp_SPc 44..249 CDD:214473 60/243 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.