DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG10469

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:238 Identity:59/238 - (24%)
Similarity:91/238 - (38%) Gaps:64/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 IKQFS------SGGYTINNTV------VPWHVGLYVW-HNEKDYHFQCGGSLLTPDLVITAAHCV 416
            |.|||      :|...|.|..      :|:.|||..: ...||....|||::|:...:||||||:
  Fly     8 IVQFSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCL 72

  Fly   417 YDEGTRL---------PYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQD 472
            .|..:.|         ..|:|...::..:.|      |...|:.|.:.:.             .|
  Fly    73 QDPKSNLWKVLIHVGKVKSFDDKEIVVNRSY------TIVHKKFDRKTVT-------------ND 118

  Fly   473 LALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGK---FAGWNIENK----HELQFVPAVS 530
            :||:.|.:....:..|:|        |:..|......|:   .:||.:..|    ..||::.|..
  Fly   119 IALIKLPKKLTFNKYIQP--------AKLPSAKKTYTGRKAIISGWGLTTKQLPSQVLQYIRAPI 175

  Fly   531 KSNSVCRR--------NLRDIQADKFCIFTQGKSLACQGDSGG 565
            .||..|.|        ..:.:..:.|......|.|.|:|||||
  Fly   176 ISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 55/226 (24%)
Tryp_SPc 371..591 CDD:304450 55/226 (24%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 54/223 (24%)
Tryp_SPc 24..260 CDD:238113 54/222 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.