DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and Jon65Ai

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:269 Identity:63/269 - (23%)
Similarity:83/269 - (30%) Gaps:79/269 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 GYTINNTVVPWHVGL-------YVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDT 429
            ||......||:.|||       ..|         ||||::....|:||.||.  :|      .::
  Fly    41 GYPAYEGKVPYIVGLGFSKNGGGTW---------CGGSIIGNTWVMTAKHCT--DG------MES 88

  Fly   430 FRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVT 494
            ..:.....:|...:.|....|.|  .||...|          |::|            ||...|.
  Fly    89 VTIYYGALWRLQAQYTHWVGRSD--FIEHGSG----------DISL------------IRTPHVD 129

  Fly   495 FASFAEKESVT--DDVQGKFAGW----------NIEN--KHELQFVPAVSKSNSVCRRNLRDIQA 545
            |.|...|..:.  ||....:.||          :.|.  ...|..|......||||.........
  Fly   130 FWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCENYYGSFSG 194

  Fly   546 DKFCIFTQGKSLACQGDSGGGFT---SELPTNAFSTWNTARHFLFGVISNAPNADQCAHSLTVMT 607
            |..||.|......|.|||||...   ........|..::|     |.:||.|..         |.
  Fly   195 DLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSA-----GCLSNGPKG---------MV 245

  Fly   608 NIQHFEDMI 616
            .:..:.|.|
  Fly   246 RVTSYLDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 62/267 (23%)
Tryp_SPc 371..591 CDD:304450 57/242 (24%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 62/267 (23%)
Tryp_SPc 41..257 CDD:238113 63/269 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436746
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.