DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:291 Identity:61/291 - (20%)
Similarity:100/291 - (34%) Gaps:99/291 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 ALCTHNGQQVECRKPFHPPGTEVKFVCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATP 364
            ||.|.:...:..:.|.||                ..||.:..::|...|          |:.|| 
  Fly    10 ALATASAGLLPQQVPIHP----------------RDLPAVTNIEGRITN----------GKTAT- 47

  Fly   365 IKQFSSGGYTINNTVVPWHVGLYV-------WHNEKDYHFQCGGSLLTPDLVITAAHC------- 415
                 ||.:       |:.|||..       |         ||||::....|:|||||       
  Fly    48 -----SGQF-------PYQVGLSFASTSGSWW---------CGGSIIDNTWVLTAAHCTSGASAV 91

  Fly   416 -VYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLD 479
             :| .|..:..|....:.::|..:..:........|.|:.||:.            ..:|...|.
  Fly    92 TIY-YGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIKT------------PTVAFTALI 143

  Fly   480 EPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGW--------NIENKHELQFVPAVSKSNSVC 536
            ...||.    .|..|::::..::::.       :||        ::.|..:.:....||.|.  |
  Fly   144 NKVELP----AIAGTYSTYTGQQAIA-------SGWGKTSDSATSVANTLQYEVFEVVSVSQ--C 195

  Fly   537 RRNLRDIQA--DKFCIFTQGKSLACQGDSGG 565
            :.....:.|  :..|:.|..|...|.|||||
  Fly   196 QNTYGSLVATNNVICVATPNKVSTCNGDSGG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 7/44 (16%)
Tryp_SPc 371..616 CDD:214473 47/220 (21%)
Tryp_SPc 371..591 CDD:304450 47/220 (21%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 52/246 (21%)
Tryp_SPc 40..269 CDD:238113 52/245 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.