Sequence 1: | NP_536776.2 | Gene: | modSP / 42032 | FlyBaseID: | FBgn0051217 | Length: | 628 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286744.1 | Gene: | CG13527 / 37615 | FlyBaseID: | FBgn0034776 | Length: | 292 | Species: | Drosophila melanogaster |
Alignment Length: | 243 | Identity: | 51/243 - (20%) |
---|---|---|---|
Similarity: | 76/243 - (31%) | Gaps: | 87/243 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 394 DYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEI 458
Fly 459 APGY------------KGRTENYYQDLALLTLDEPFELS-------HVIRPICVTFASFAEKESV 504
Fly 505 TDDVQGKFAGWNIENKHELQF----------VPAVSKSNSVCRRNLRDIQADKFCIFTQGKSL-- 557
Fly 558 -ACQGDSGGGFTS-----------------ELP---TNAFSTWNTARH 584 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
modSP | NP_536776.2 | LDLa | 27..58 | CDD:197566 | |
LDLa | 70..101 | CDD:197566 | |||
LDLa | 123..157 | CDD:197566 | |||
LDLa | 167..199 | CDD:238060 | |||
CCP | <251..284 | CDD:153056 | |||
Sushi | 309..354 | CDD:278512 | |||
Tryp_SPc | 371..616 | CDD:214473 | 51/243 (21%) | ||
Tryp_SPc | 371..591 | CDD:304450 | 51/243 (21%) | ||
CG13527 | NP_001286744.1 | Tryp_SPc | 43..266 | CDD:238113 | 51/243 (21%) |
Tryp_SPc | 43..263 | CDD:214473 | 49/239 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |