DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and scaf

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:664 Identity:137/664 - (20%)
Similarity:205/664 - (30%) Gaps:218/664 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FAACDSSQFECDNGSCISQYDVCNGEK--NCPDGSDETALTCVSQRQHCTKPYFQCTY---GACV 83
            |..|...|....:|.|::.|......|  ||    |.....|             |||   ....
  Fly    81 FLKCAPGQQCVRSGQCLNGYFAQQLPKIQNC----DPETTVC-------------CTYRPPPTTT 128

  Fly    84 IGTAGCNGVNECADGSDETRLRCGNEDDIRQHDRRLQGNCKENEF------------KCPSG--I 134
            ..|.....|..||..||     |...|           ||:..|.            :||:.  .
  Fly   129 TTTTTSVPVANCAYDSD-----CVTPD-----------NCRNGEISAINYVKKQGPNRCPAPNIC 177

  Fly   135 CLDKSNFLCDGKDDCADGTGFDESVELCGHMECPAYSFKCGTGGCISGSLSCNGENDCYDGSDEA 199
            |...|..|.:      ||..|:          .|..:|...|...:...           .|.:|
  Fly   178 CRIPSTTLTE------DGYIFN----------LPEKTFPLPTKPAVLAM-----------PSTQA 215

  Fly   200 P------------------LLCNTT-----KKVTT---PV------VTETPLELLGCPLPLGDER 232
            |                  |..:||     :||.|   ||      .||:...|:....|..:.|
  Fly   216 PFRPQPTTAVPASRPTIEYLPPSTTQHPSYEKVQTSRRPVYLPPSPATESASSLIPKIRPRPEPR 280

  Fly   233 PILTGDGSRVLTGPITRGTV-RFSCKQGYVLEGEESSYCAKNKWSTSTIP------------KCV 284
            |..|...:.....|.....: ||...:......::..|..:::.|....|            ||.
  Fly   281 PQPTRRPTNEYLPPAAANEIPRFEPDRAPQPSNQKPIYRGEDQLSPQIFPTPQPANVPKHFAKCA 345

  Fly   285 --------KYCSTAG--------------EFDGYSTKALCTHNGQQVE-CRKPFH--PPGTEVKF 324
                    .:|:..|              .|....|..|.|.||...: ||.|.:  |....:..
  Fly   346 SALVCTSENFCNAIGVLSETPVELSPMEAAFRVPLTDCLQTENGSPGKCCRDPNYVDPWPVNLAG 410

  Fly   325 VCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVW 389
            ||:|..|...|                           |.:|...:     |...:||...:.  
  Fly   411 VCATRNKRTKP---------------------------TGVKDLDA-----NFAEIPWQAMIL-- 441

  Fly   390 HNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTP--EEKRRD 452
             .|......|||:::....|:::|.||    ..||.:  ..||.|.::  ..|.|..  ..:...
  Fly   442 -RESSKTLICGGAIIGDQFVLSSASCV----NGLPVT--DIRVKAGEW--ELGSTNEPLPFQLTG 497

  Fly   453 VRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNI 517
            |:.:::.|.|...|.::  |||::.|:...|.:..|:|||::      .|...|..|...:||..
  Fly   498 VKTVDVHPDYDPSTNSH--DLAIIRLERRLEFASHIQPICIS------DEDPKDSEQCFTSGWGK 554

  Fly   518 E--NKHE----LQFVPAVSKSNSVCRRNLRDI-QADKF--CIFTQGKSLACQGDSG----GGFTS 569
            :  :.||    :.....:.::.|.|..:...: .|.||  |.|..|.:|||...|.    |.|..
  Fly   555 QALSIHEEGALMHVTDTLPQARSECSADSSSVCSATKFDSCQFDVGSALACGSGSSVRLKGIFAG 619

  Fly   570 ELPTNAFSTWNTAR 583
            |   |:.....|.|
  Fly   620 E---NSCGEGQTVR 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566 8/32 (25%)
LDLa 70..101 CDD:197566 8/33 (24%)
LDLa 123..157 CDD:197566 10/47 (21%)
LDLa 167..199 CDD:238060 4/31 (13%)
CCP <251..284 CDD:153056 6/45 (13%)
Sushi 309..354 CDD:278512 9/47 (19%)
Tryp_SPc 371..616 CDD:214473 56/228 (25%)
Tryp_SPc 371..591 CDD:304450 56/228 (25%)
scafNP_610180.1 FtsK <198..>334 CDD:332908 26/146 (18%)
Tryp_SPc 428..616 CDD:238113 50/211 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.