DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG9377

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:406 Identity:91/406 - (22%)
Similarity:145/406 - (35%) Gaps:121/406 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 SSYCAKNKWSTSTIPKCVKY--CSTAGEFDG--YSTKALCT--HNGQQVE--CRKPFHPPGTEVK 323
            |..|...|       .||.|  |:.....||  |..::..|  .|...:|  |..|...|..:: 
  Fly    22 SKVCGPEK-------HCVPYEQCNEGLMVDGKFYPDRSRTTLDENCHYMEKCCNIPDKLPTPKI- 78

  Fly   324 FVCSTGFKTLSPLPEMRCMKGG-----YWNR--GRQRCEQDCGQLATPIKQFSSGGYTINNTVVP 381
                       |...|.|..||     |:.|  |.::.|...|:.                   |
  Fly    79 -----------PEEMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEF-------------------P 113

  Fly   382 WHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYG-ETT 445
            |.|.:|    ..|.:. |.|:|:||..|||.||||.:.      ..:..|::|.::..... |..
  Fly   114 WLVAVY----GSDTYL-CSGALITPLAVITTAHCVQNS------EMEKVRLLAGEWDAAVELEPQ 167

  Fly   446 PEEKRRDVRLIEIAPGYKGRTENYYQ-----DLALLTLD--EPFELSHVIRPICVTFASFAEKES 503
            |.::|..|..: :.|       ||.|     ::|:|.:|  :||:|:..::|||:.........|
  Fly   168 PHQQRSVVETL-VHP-------NYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYS 224

  Fly   504 VTDDVQGKFAGWN---------IENKHELQFVPAVSKSNSVCRRNLRDIQADKFCIFTQGK---- 555
                 |...:||.         :..:..|..:|.     ..||..||        :...|:    
  Fly   225 -----QCYVSGWQRSDFGRAAILPKRWTLYVLPP-----DQCRTKLR--------LSLLGRRHAH 271

  Fly   556 --SLACQGDSGGGFT------SELPTNAFSTWNTARHFLFGVISNAPNADQCAHSLTVMTNIQHF 612
              ||.|.|...|.|.      :.:|.....:.:..|..|.|:::.....|. ...|.:.||::.:
  Fly   272 NDSLLCAGGDKGDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDG-PQLLGIYTNVKLY 335

  Fly   613 EDMI-LNAMNRSVETR 627
            ...| |....|:::.|
  Fly   336 RQWIDLKLRERNLDIR 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056 3/16 (19%)
Sushi 309..354 CDD:278512 12/53 (23%)
Tryp_SPc 371..616 CDD:214473 61/273 (22%)
Tryp_SPc 371..591 CDD:304450 57/248 (23%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 63/291 (22%)
Tryp_SPc 105..339 CDD:214473 63/290 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.