DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and psh

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:406 Identity:103/406 - (25%)
Similarity:152/406 - (37%) Gaps:120/406 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 TSTIPKCVKYCSTAGE----FDGYSTKALCTHN----------GQQVEC-RKPFHPPGTEVKFVC 326
            |.|:|   ..|.|:.:    .|||....:.|.|          |:...| .||.....|......
  Fly    33 TDTMP---GICRTSSDCEPLIDGYIKSGVLTLNDVPSCGLGAWGEIFCCP
TKPCCDNSTITSVST 94

  Fly   327 STGFKTLSPLPEMR----------------CMKGGYWNRGRQRCEQDCG-QLATPIKQFSSGGYT 374
            |:...|.:|:...|                |.|      .|:|.:|..| ||...|    .|||.
  Fly    95 SSTTSTKAPMTSGRVDVPTFGSGDRPAVAACKK------IRERKQQRSGNQLVIHI----VGGYP 149

  Fly   375 INNTVVPWH---VGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAK 436
            ::..|.| |   :|...:..:    |:|||||:....|:||||||..:.     :...|..:.|.
  Fly   150 VDPGVYP-HMAAIGYITFGTD----FRCGGSLIASRFVLTAAHCVNTDA-----NTPAFVRLGAV 204

  Fly   437 FYRNYGETTPEEKRRD--VRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFA 499
            ...|     |:...:|  :|.::|.|.|.|   |.|.|:|:|.|:.....:..|||.|:      
  Fly   205 NIEN-----PDHSYQDIVIRSVKIHPQYVG---NKYNDIAILELERDVVETDNIRPACL------ 255

  Fly   500 EKESVTDDVQGKF--AGWNIENKHELQFVPAVSKSNSVCRRNLRDIQADKFC------------I 550
            ..::.......||  |||.:.|      |...::|..:.|..|..:..|: |            :
  Fly   256 HTDATDPPSNSKFFVAGWGVLN------VTTRARSKILLRAGLELVPLDQ-CNISYAEQPGSIRL 313

  Fly   551 FTQG--KSL-----------ACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCAHS 602
            ..||  .||           ||:|||||....||..      ....:.:.||||:...   || :
  Fly   314 LKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNV------EDGMYTIMGVISSGFG---CA-T 368

  Fly   603 LT--VMTNIQHFEDMI 616
            :|  :.|.:..:.|.|
  Fly   369 VTPGLYTRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056 3/6 (50%)
Sushi 309..354 CDD:278512 11/61 (18%)
Tryp_SPc 371..616 CDD:214473 74/278 (27%)
Tryp_SPc 371..591 CDD:304450 67/251 (27%)
pshNP_573297.1 CLIP 30..79 CDD:197829 11/48 (23%)
Tryp_SPc 143..384 CDD:214473 75/285 (26%)
Tryp_SPc 144..387 CDD:238113 76/286 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.