DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and Hayan

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:266 Identity:74/266 - (27%)
Similarity:117/266 - (43%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 GYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAK 436
            |..::..|.| |:....:::.....|:|||||:....|:||||||..:.     |..:|..:.|.
  Fly   388 GERVDRGVYP-HMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDD-----STPSFVRLGAL 446

  Fly   437 FYRNYGETTPEEKRRDVRLI--EIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFA 499
            ...|     ||...:|:.:|  :|.|.|.|.::  |.|:|:|.|.|..:.|.||||.|:    :.
  Fly   447 NIEN-----PEPGYQDINVIDVQIHPDYSGSSK--YYDIAILQLAEDAKESDVIRPACL----YT 500

  Fly   500 EKESVTDDVQGKFAGWNIEN-----------KHELQFVPA------VSKSNSVCRRNLRDIQADK 547
            ::.....:.:...|||.:.|           :..|..|||      .::..|..|...|.:.|.:
  Fly   501 DRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQ 565

  Fly   548 FCIFTQG-KSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCAHSLT-VMTNIQ 610
            .|...:. :..||||||||....|: .:...|::     :.||||:...   ||.... :.|.:.
  Fly   566 LCAADKNQRKDACQGDSGGPLILEI-DDVDGTYS-----IVGVISSGFG---CATKTPGLYTRVS 621

  Fly   611 HFEDMI 616
            .|.|.|
  Fly   622 SFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 73/264 (28%)
Tryp_SPc 371..591 CDD:304450 66/238 (28%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 73/264 (28%)
Tryp_SPc 385..630 CDD:238113 74/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.