Sequence 1: | NP_536776.2 | Gene: | modSP / 42032 | FlyBaseID: | FBgn0051217 | Length: | 628 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573148.2 | Gene: | sphe / 32648 | FlyBaseID: | FBgn0030774 | Length: | 249 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 50/206 - (24%) |
---|---|---|---|
Similarity: | 80/206 - (38%) | Gaps: | 35/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 371 GGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAA 435
Fly 436 KFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAE 500
Fly 501 ------KESVTDDVQGKFAGW----NIENKHELQFVPAVSKSNSVCRRNLRDIQADKFCIFTQGK 555
Fly 556 SLACQGDSGGG 566 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
modSP | NP_536776.2 | LDLa | 27..58 | CDD:197566 | |
LDLa | 70..101 | CDD:197566 | |||
LDLa | 123..157 | CDD:197566 | |||
LDLa | 167..199 | CDD:238060 | |||
CCP | <251..284 | CDD:153056 | |||
Sushi | 309..354 | CDD:278512 | |||
Tryp_SPc | 371..616 | CDD:214473 | 50/206 (24%) | ||
Tryp_SPc | 371..591 | CDD:304450 | 50/206 (24%) | ||
sphe | NP_573148.2 | Tryp_SPc | 42..247 | CDD:238113 | 47/192 (24%) |
Tryp_SPc | 42..244 | CDD:214473 | 47/192 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45436914 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |