DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG31269

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:260 Identity:63/260 - (24%)
Similarity:93/260 - (35%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 GGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAA 435
            ||....:...|:.:.|   ......| .|||:::....|:||||||  |...:|:   ...|...
  Fly    40 GGQAAEDGFAPYQISL---QGISGAH-SCGGAIINETFVLTAAHCV--ENAFIPW---LVVVTGT 95

  Fly   436 KFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAE 500
            ..|...|      .|..::.|.|...|.  ....:.|:|||.|.||.......:||.:.......
  Fly    96 NKYNQPG------GRYFLKAIHIHCNYD--NPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQP 152

  Fly   501 KESVTDDVQGKFAGWNIE----NKHELQFVPAVSKSNSVCR---RNLRDIQADKFCIFTQGKSLA 558
            .:.|.....|....|...    ....||:||     :..|:   .|..|......|.|::....|
  Fly   153 GDEVILTGWGSTVLWGTSPIDLQVLYLQYVP-----HRECKALLSNDEDCDVGHICTFSRLGEGA 212

  Fly   559 CQGDSGGGFTSELPTNAFSTWNTARHFLFGVIS-NAPNADQCAHSL-TVMTNIQHFEDMILNAMN 621
            |.|||||...|             ..:|.|::: ..|    ||..: .|..::..:.|.|.|.|:
  Fly   213 CHGDSGGPLVS-------------NGYLVGLVNWGWP----CATGVPDVHASVYFYRDWIRNVMS 260

  Fly   622  621
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 60/253 (24%)
Tryp_SPc 371..591 CDD:304450 55/226 (24%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 60/253 (24%)
Tryp_SPc 38..258 CDD:238113 61/256 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.