DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG31205

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:251 Identity:59/251 - (23%)
Similarity:93/251 - (37%) Gaps:53/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 QDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCV-YDE 419
            |:||....  ||::|.......|..||.|.:.....:......|.|.|:....|:|||||| .||
  Fly    27 QECGIFNE--KQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDE 89

  Fly   420 GTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIE---IAPGYKGRTENYYQDLALLTLDEP 481
            ...:                 ||....:....::.|:.   :.|.|..|  .:..|||::.|.:.
  Fly    90 SESI-----------------YGVVFGDSDSSNINLVSAVTVHPDYSPR--KFENDLAIIELTKE 135

  Fly   482 FELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNIENKHELQFVPAVSKSNSVCRRNLRDIQA- 545
            ...|.:::|||:...|.....|.|.:.:...||  :|.       |:..:.:|..:|..:.|:. 
  Fly   136 VVFSDLVQPICLPSVSEMVPGSETSNSKLIVAG--LEG-------PSFDRRHSATQRLDKRIKMT 191

  Fly   546 -----DKFCIFTQGK---SLACQGDSGGGFTSELPTNAFS---TWNTARHF-LFGV 589
                 .|.|...|.:   .|.|      |.|...|.:..:   ...|.|.| |.|:
  Fly   192 YTKIDSKECHEKQARFPEELIC------GHTERSPLSGSALTEASGTPRQFHLLGI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 53/236 (22%)
Tryp_SPc 371..591 CDD:304450 53/236 (22%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 33/142 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.