DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG11664

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:230 Identity:54/230 - (23%)
Similarity:72/230 - (31%) Gaps:92/230 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 VPW----HVGLYVWHNEKDY-------HFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVI 433
            |.|    |.|:.|......|       .|...|||.:...|:|.|||                  
  Fly    17 VRWGDALHRGIPVQQQNYGYVMQIYGPQFLAAGSLFSARYVLTVAHC------------------ 63

  Fly   434 AAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENY-------------------YQDLALLTLD 479
               |.:|   |.|||       :.:..||:.....:                   ..|:|:|.:.
  Fly    64 ---FKKN---TKPEE-------LSVRAGYRWIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVK 115

  Fly   480 EPFELSHVI-------RPICVTFASFAEKESVTDDVQGKFAGWNIENKHELQFVPAVSKSNSV-- 535
            .....||:|       ||: .....||..:        :.||||      |..:....||.||  
  Fly   116 AAISHSHMINYIGLCSRPL-TPLNMFAPPQ--------ELAGWN------LMHIAQPLKSMSVQV 165

  Fly   536 -----CRRNLRDIQADKFCI-FTQGKSLACQGDSG 564
                 ||:....|.....|. .|.|:.| |.||||
  Fly   166 EPEKNCRQWFPQISGGVICASATMGEGL-CYGDSG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 54/230 (23%)
Tryp_SPc 371..591 CDD:304450 54/230 (23%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 48/209 (23%)
Tryp_SPc 38..237 CDD:214473 48/209 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.