DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG33462

DIOPT Version :10

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:42 Identity:12/42 - (28%)
Similarity:18/42 - (42%) Gaps:10/42 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FLHFTVMFPVAAISFVLFWALFV------FDRT--LVIPQAK 100
            |..|.:.||:  |..::.|.|..      .|||  ..:|.|:
  Fly     4 FNRFRLSFPL--ILLLVCWHLQAPAGVSSLDRTDNATVPLAR 43

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566 11/39 (28%)
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Tryp_SPc 371..616 CDD:214473
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.