DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and Sp212

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:258 Identity:74/258 - (28%)
Similarity:105/258 - (40%) Gaps:65/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 CGQ--LATPI----KQFSSGGYTINNTVVPWHVGLYVWHNE-KDYHFQCGGSLLTPDLVITAAHC 415
            ||:  ..||.    .:|..|.|       ||...:|  |.| :...|:|.|||::..:||:||||
  Fly   267 CGREGSTTPFIVRGNEFPRGQY-------PWLSAVY--HKEVRALAFKCRGSLISSSIVISAAHC 322

  Fly   416 VYDEGTRLP----------YSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYY 470
            |:    |:.          |..|           :|||...|  .|:|..:...|.|  .|.:|.
  Fly   323 VH----RMTEDRVVVGLGRYDLD-----------DYGEDGAE--MRNVMRLLWHPDY--NTRSYS 368

  Fly   471 Q-DLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGW-NIENKHELQF---VPAVS 530
            . |:||:|::.|...:.:|.|||:    :..:.|.|....|..||| ..|:....|:   |.|..
  Fly   369 DADIALITIERPVTFNDIIAPICM----WTVEASRTVSTTGFIAGWGRDEDSSRTQYPRVVEAEI 429

  Fly   531 KSNSVCRRNLRD--IQADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVIS 591
            .|.:||....|.  :.....|...:..|..|.||||||    |.......|     .|.|::|
  Fly   430 ASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGG----LMVKQGDRW-----LLRGIVS 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 69/239 (29%)
Tryp_SPc 371..591 CDD:304450 68/237 (29%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 70/248 (28%)
Tryp_SPc 277..511 CDD:214473 70/248 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.