DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG30286

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:331 Identity:74/331 - (22%)
Similarity:122/331 - (36%) Gaps:92/331 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 PFHPPGTEVKFVCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATPIKQFSSGGYTINNT 378
            |:||..|                              .|..|.|||.::....|.......|:.:
  Fly    12 PWHPHAT------------------------------AQFLEPDCGYMSPEALQNEEHQAHISES 46

  Fly   379 VVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYR---- 439
              ||...|:     |.....|||:|:....::|||||:.::        :...|...:|..    
  Fly    47 --PWMAYLH-----KSGELVCGGTLVNHRFILTAAHCIRED--------ENLTVRLGEFNSLTSI 96

  Fly   440 --NYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKE 502
              |..:..|..:..::.:.....|| .|| |...|:.||.|.:..|....|:|||:         
  Fly    97 DCNGSDCLPPSEDFEIDVAFRHGGY-SRT-NRIHDIGLLRLAKSVEYKVHIKPICL--------- 150

  Fly   503 SVTD-DVQGKF--------AGW----NIENKHELQFVPAVSKSNSVCRRNL-RDIQADKFCIFTQ 553
             :|: .:|.|.        .||    :....|.|:.:.....:..||.:.. .|.:.|:.|: :.
  Fly   151 -ITNTTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKTYWVDRRRDQICV-SH 213

  Fly   554 GKSLACQGDSGGGFTSELPTNAFSTWNTARHFLF---GVISNAPNADQCAHSLTVMTNIQHFEDM 615
            ...::|.|||||.....:..:.        ..||   |::|.. || :|. |.:|.||:....|.
  Fly   214 ESGVSCSGDSGGPMGQAIRLDG--------RVLFVQVGIVSYG-NA-ECL-SPSVFTNVMEHIDW 267

  Fly   616 ILNAMN 621
            |:.|::
  Fly   268 IMAALS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 5/39 (13%)
Tryp_SPc 371..616 CDD:214473 62/267 (23%)
Tryp_SPc 371..591 CDD:304450 53/242 (22%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 62/268 (23%)
Tryp_SPc 39..268 CDD:214473 62/267 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.