DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG30098

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:251 Identity:68/251 - (27%)
Similarity:104/251 - (41%) Gaps:53/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 GGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHC--VYDE-GTRLPYSYDTFRV 432
            ||.....|  ||...|.     :|..|.|||||:....|:|||||  :.|. ..||. .||:.| 
  Fly    39 GGQNARRT--PWMAYLI-----RDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLG-EYDSSR- 94

  Fly   433 IAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYY----QDLALLTLDEPFELSHVIRPICV 493
                        |.:.:.|..|::.|.     |.:||.    .|:|:|.||........|||||:
  Fly    95 ------------TTDGQTRSYRVVSIY-----RHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICI 142

  Fly   494 TFASFAEKESVTDDVQG-KFAGWNIENKHELQFVPAVSKSNSVCRRNLRD----IQADKFCIFTQ 553
            ...|  ..:|:.:.:|. ...||. :..|..: :|...:..|:  |.:|:    :.:...|.:..
  Fly   143 LLNS--GLQSLANSIQNFTLTGWG-QMAHYYK-MPTTLQEMSL--RRVRNEYCGVPSLSICCWNP 201

  Fly   554 GKSLACQGDSGGGFTSELPTNAFSTWNTARHFL-FGVISNAP-NADQCAHSLTVMT 607
             ...||.|||||      |..:...:.....:: |||.::.. |.|..:..|.:|:
  Fly   202 -VQYACFGDSGG------PLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 68/251 (27%)
Tryp_SPc 371..591 CDD:304450 64/232 (28%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 68/251 (27%)
Tryp_SPc 37..258 CDD:238113 68/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.