DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG30090

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:292 Identity:77/292 - (26%)
Similarity:118/292 - (40%) Gaps:60/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 EQDCGQLATPIKQFSSGG--YTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVY 417
            |..||..|..|.....||  ..||:.  ||..  |:..:.|   ..|||:|:|...|:|||||| 
  Fly    26 EPRCGLTANTIAFKIIGGRDAIINSN--PWMA--YIHSSVK---LICGGTLITQRFVLTAAHCV- 82

  Fly   418 DEGTRLPYSYDTFRVIAAKFYRNYGETTPEE-------KRRDVRLIEIA--PGYKGRTENYYQDL 473
            :||:.:.....           .|.:|..|:       .|.:...:::|  .|.....:| ..|:
  Fly    83 NEGSAVKVRLG-----------EYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKN-LNDI 135

  Fly   474 ALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFA-GWNIENKHE----LQFVPAVSKSN 533
            |||.|.:.......|.|||:...:  .|..:.|.::...| ||.....|.    ||.......::
  Fly   136 ALLRLAKFVTFKAHISPICIILGT--SKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNS 198

  Fly   534 SVCRRNL-RDIQADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHF------LFGVIS 591
            |.|.:.| |.:|.::.|....| |..|.|||||           ..:.|.||.      .|||:|
  Fly   199 SQCMQALGRLVQQNQICAGRLG-SDTCNGDSGG-----------PLFQTVRHMDKMRPVQFGVVS 251

  Fly   592 NAPNADQCAHSLTVMTNIQHFEDMILNAMNRS 623
            .  .:.:|: .:.|.|::..:.|.|...:.::
  Fly   252 Y--GSRECS-GIGVYTDVYSYADWIATVVQQN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 71/267 (27%)
Tryp_SPc 371..591 CDD:304450 66/242 (27%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 71/270 (26%)
Tryp_SPc 40..276 CDD:238113 72/272 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.