DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG30087

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:271 Identity:59/271 - (21%)
Similarity:96/271 - (35%) Gaps:89/271 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 LYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYD-----------------EGTRL-PYS--YDTF 430
            :||.:|...:   ||||:|....::||||||:.                 :|:.. |.|  |...
  Fly    57 VYVTNNSLTH---CGGSILNSRYILTAAHCVFPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIM 118

  Fly   431 RVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICV-- 493
            :.|..:||                          ...|:..|:|||.|:.....:..|:|||:  
  Fly   119 KAITHRFY--------------------------NAANHVNDIALLKLNRSINFNVHIQPICILL 157

  Fly   494 ---------TFASFAEKESVTDDVQGKFAGWNIENK----HELQFVPAVSKSNSVCRRNLRD-IQ 544
                     |:.:|               ||....|    |.||.....:...:.|.|:... :.
  Fly   158 NPASAPSVATYQTF---------------GWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMN 207

  Fly   545 ADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCAHSLTVMTNI 609
            .::.|...:.:. .|.|||||...:.:..:     ...|:...|::|..|...|   |..|.|.:
  Fly   208 GNQICAGHEERD-TCAGDSGGPLVTRVDFD-----GVKRYLQLGIVSYGPTDCQ---SPGVYTYV 263

  Fly   610 QHFEDMILNAM 620
            .::.:.|..||
  Fly   264 PNYINWIRRAM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 56/265 (21%)
Tryp_SPc 371..591 CDD:304450 50/240 (21%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 56/265 (21%)
Tryp_SPc 42..272 CDD:238113 57/267 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.