DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG30083

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:290 Identity:63/290 - (21%)
Similarity:111/290 - (38%) Gaps:76/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 QRCEQDCG--QLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAH 414
            |..|.:||  .::..|..    |....|...||...::.:::::.....|||:|:....|::|||
  Fly    19 QFLEPNCGYPDISPKIMH----GQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAH 79

  Fly   415 CVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGR---TENYYQDLALL 476
            |:..:           :::|.:.    ||.:..      |...:...::.:   |.:|..|:.:|
  Fly    80 CIKRD-----------QILAVRL----GEHSSS------RYFAVTKAFRNKYFTTGSYSNDIGIL 123

  Fly   477 TLDEPFELSHVIRPICVTFASFAEKESVTDDVQ------GKFAGWNIENKHELQFVPAVSKSNSV 535
            .:....:.:.||||||:          :||..:      .|.|||   .|.|.:....|.|:..:
  Fly   124 RIQPIVKFNAVIRPICI----------ITDPTKVPNVKTFKAAGW---GKTENETFSKVLKTVEL 175

  Fly   536 CRRNLRDIQADKFCIFTQGKSLA-------CQGDSGGGFTSELPTNAFSTWNTARHFLFGVIS-- 591
            ...|..:.....:...|:.:..|       |.|||||.....:..:     .:.|:...|:||  
  Fly   176 NELNASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMD-----GSLRYVQLGIISFG 235

  Fly   592 ----NAPNADQCAHSLTVMTNIQHFEDMIL 617
                |:|.         |.|.:..|.|.||
  Fly   236 SSLCNSPG---------VYTRLSSFIDWIL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 1/1 (100%)
Tryp_SPc 371..616 CDD:214473 56/266 (21%)
Tryp_SPc 371..591 CDD:304450 48/235 (20%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 57/273 (21%)
Tryp_SPc 34..255 CDD:238113 57/272 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.