DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and Sez6l2

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_030098390.1 Gene:Sez6l2 / 233878 MGIID:2385295 Length:930 Species:Mus musculus


Alignment Length:303 Identity:65/303 - (21%)
Similarity:99/303 - (32%) Gaps:118/303 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 SFKCGTGGCISGS--LSCNGENDCYDGS-DEAPLLCNTTKKVTTPVVTETPLELLGCPLPLGDER 232
            :::|..|..:.||  |:|.     :|.| ..||..|   :|:.|            |..|     
Mouse   669 TYQCEPGYELLGSDILTCQ-----WDLSWSAAPPAC---QKIMT------------CADP----- 708

  Fly   233 PILTGDGSRVLTGPITRG-------------TVRFSCKQGYVLEGEESSYCAKN-----KWSTST 279
                        |.||.|             .|::.|..||.|||.....|...     ||| ..
Mouse   709 ------------GEITNGHRTASDAGFPVGSHVQYRCLPGYSLEGAAVLTCYSRDTGTPKWS-DR 760

  Fly   280 IPKC-VKY--CSTAG-EFDGYSTKALCTHNGQQVECRKPFHPPGTEVKFVCSTGFKTLSPLPEMR 340
            :||| :||  |...| ..:||.|  |..|:.|          .|..::|.|..||:.:..: .:.
Mouse   761 VPKCALKYEPCLNPGVPENGYQT--LYKHHYQ----------AGESLRFFCYEGFELIGEV-TIT 812

  Fly   341 CMKG--GYWNRGRQRC-----------EQDCGQLATPIKQFSSGGYTIN-----NTVVPWHVGLY 387
            |:.|  ..|......|           :.:..|...|.:|...|...:.     ..|:...:|:|
Mouse   813 CVPGHPSQWTSQPPLCKVAYEELLDNRKLEVTQTTDPSRQLEGGNLALAILLPLGLVIVLGIGVY 877

  Fly   388 VWHN---------------------EKDYH---FQCGGSLLTP 406
            :::.                     |.|:.   ::.|.||..|
Mouse   878 IYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEAGVSLSPP 920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060 8/30 (27%)
CCP <251..284 CDD:153056 14/38 (37%)
Sushi 309..354 CDD:278512 8/46 (17%)
Tryp_SPc 371..616 CDD:214473 10/65 (15%)
Tryp_SPc 371..591 CDD:304450 10/65 (15%)
Sez6l2XP_030098390.1 CUB 173..285 CDD:238001
CCP 290..345 CDD:153056
CUB 349..>417 CDD:238001
Sushi 466..523 CDD:365861
CUB 527..617 CDD:238001
PHA02927 <665..828 CDD:222943 51/209 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.