DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and F10

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:528 Identity:112/528 - (21%)
Similarity:177/528 - (33%) Gaps:172/528 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GHMECPAYSFKCGTGGCISGSLSCNGENDCYDGSDEAPLLCNTTKKVTTPVVTETPLELLGCPLP 227
            ||:|          ..|:..:.|.....:.::.||:.....|..|                    
Human    51 GHLE----------RECMEETCSYEEAREVFEDSDKTNEFWNKYK-------------------- 85

  Fly   228 LGDERPILTGDGSRVLTGPITRGTVRFSCKQGYVLEGEESSYCAKNKWSTSTIPKCVKYCSTAGE 292
                      ||.:..|.|...   :..||.|.   ||.:..|.:.                   
Human    86 ----------DGDQCETSPCQN---QGKCKDGL---GEYTCTCLEG------------------- 115

  Fly   293 FDGYS----TKALCT-HNGQQVECRKPFHPPGTEVKFVCSTGFKTLSPLPEMRCMKGGYWNRGRQ 352
            |:|.:    |:.||: .||   :|.:..|.....|...|:.|: ||:...: .|:..|.:..|:|
Human   116 FEGKNCELFTRKLCSLDNG---DCDQFCHEEQNSVVCSCARGY-TLADNGK-ACIPTGPYPCGKQ 175

  Fly   353 RCEQ------------------------DCGQLATPIKQFS-------------------SGGYT 374
            ..|:                        |...|......|.                   .||..
Human   176 TLERRKRSVAQATSSSGEAPDSITWKPYDAADLDPTENPFDLLDFNQTQPERGDNNLTRIVGGQE 240

  Fly   375 INNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYR 439
            ..:...||...|.   ||::..| |||::|:...::|||||:|.               |.:|..
Human   241 CKDGECPWQALLI---NEENEGF-CGGTILSEFYILTAAHCLYQ---------------AKRFKV 286

  Fly   440 NYGE--TTPEEKRRDVRLIEIAPGYKGRT-ENYYQDLALLTLDEPFELSHVIRPICVTFASFAEK 501
            ..|:  |..||....|..:|:...:...| |.|..|:|:|.|..|......:.|.|:....:||.
Human   287 RVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAES 351

  Fly   502 ESVTDDVQGKFAGWNIENKHE---------LQFVPAVSKSNSVCRRNLRDIQADKFCI-FTQGKS 556
            ..:|... |..:|:.  ..||         :..||.|.: ||....:...|..:.||. :...:.
Human   352 TLMTQKT-GIVSGFG--RTHEKGRQSTRLKMLEVPYVDR-NSCKLSSSFIITQNMFCAGYDTKQE 412

  Fly   557 LACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCAH--SLTVMTNIQHFEDMILNA 619
            .||||||||...:.....         :|:.|::|   ..:.||.  ...:.|.:..|    |..
Human   413 DACQGDSGGPHVTRFKDT---------YFVTGIVS---WGEGCARKGKYGIYTKVTAF----LKW 461

  Fly   620 MNRSVETR 627
            ::||::||
Human   462 IDRSMKTR 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060 4/31 (13%)
CCP <251..284 CDD:153056 6/32 (19%)
Sushi 309..354 CDD:278512 11/44 (25%)
Tryp_SPc 371..616 CDD:214473 66/259 (25%)
Tryp_SPc 371..591 CDD:304450 61/232 (26%)
F10NP_000495.1 GLA 25..85 CDD:214503 8/43 (19%)
EGF_CA 86..122 CDD:238011 12/60 (20%)
FXa_inhibition 129..164 CDD:317114 10/39 (26%)
O-glycosylated at one site 183..203 0/19 (0%)
Tryp_SPc 235..464 CDD:238113 67/267 (25%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.