DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG42694

DIOPT Version :9

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:253 Identity:53/253 - (20%)
Similarity:92/253 - (36%) Gaps:73/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 CG-----QLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVY 417
            ||     |..|.::|..:|               ::.|.....|..|.|||::...|::||.|:.
  Fly    27 CGAPISNQSITKLRQPQAG---------------WLAHISNGTHVLCSGSLISKQFVLSAAQCID 76

  Fly   418 DEG-----------TRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQ 471
            ..|           |:.|:.|....|                         :.|.:.|:  ...:
  Fly    77 VHGKLFVQLGVSNATKSPHWYTVSNV-------------------------VIPSHSGK--RLQR 114

  Fly   472 DLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQ--GKF--AGWNIENKHELQFVPAVSKS 532
            |:.||.|.:..:.:..:.|||:     |...:..|.|:  ..|  :.|..:||:. |.:.....|
  Fly   115 DIGLLKLSQSVDYNDFVYPICI-----ALNTNTLDMVKILQNFTTSAWLSKNKNP-QTIVLSQLS 173

  Fly   533 NSVCRRNLR-DIQADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGV 589
            ...|:.||. ::...:.|..:..::.:|..|||...|..:...:    |..|..|||:
  Fly   174 RDRCKLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGS----NIVREMLFGI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 48/235 (20%)
Tryp_SPc 371..591 CDD:304450 48/235 (20%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 47/219 (21%)
Tryp_SPc 46..253 CDD:214473 47/219 (21%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.