DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14906 and Mettl3

DIOPT Version :9

Sequence 1:NP_650573.1 Gene:CG14906 / 42030 FlyBaseID:FBgn0015351 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_651204.1 Gene:Mettl3 / 42844 FlyBaseID:FBgn0039139 Length:608 Species:Drosophila melanogaster


Alignment Length:479 Identity:78/479 - (16%)
Similarity:152/479 - (31%) Gaps:177/479 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KTLINEAYDEFKLKSELFQFHAKKTDKGIEEDKTRKRKRKAGVEDASSL---EDLHLV------- 74
            |.::.:..|..:.|.|..:...:..|....::||.|.:.....::::||   :|:.::       
  Fly   124 KEILEDTNDTCQQKEEEAKRKLEVDDVDQPQEKTIKLESTVARKESTSLDAPDDIMMLLSMPSTR 188

  Fly    75 --------NEYLELLSKPV---------------------------------------------- 85
                    .|.||||:||.                                              
  Fly   189 EKQSKQVGEEILELLTKPTAKERSVAEKFKSHGGAQVMEFCSHGTKVECLKAQQATAEMAAKKKQ 253

  Fly    86 EPEDSSPMKRHWEDGYN----VPQLHGANESGRM------------------------------- 115
            |..|...::...:.|.|    ||:...|.|.|.:                               
  Fly   254 ERRDEKELRPDVDAGENVTGKVPKTESAAEDGEIIAEVINNCEAESQESTDGSDTCSSETTDKCT 318

  Fly   116 -QRFLRV-----DGSRGVYLIPN------QSRFFNHNVDNLPAL--------------------- 147
             ..|.::     |.|.|.....|      ..::.::.||.||.:                     
  Fly   319 KLHFKKIIQAHTDESLGDCSFLNTCFHMATCKYVHYEVDTLPHINTNKPTDVKTKLSLKRSVDSS 383

  Fly   148 --LH--------------QLLPAYDLIVLDPPWRNKYIRRLKRAKPELGYSMLSNEQLSHIPLSK 196
              |:              .:|..:.:::.||||         ....||.|..:|::::..:.:..
  Fly   384 CTLYPPQWIQCDLRFLDMTVLGKFAVVMADPPW---------DIHMELPYGTMSDDEMRALGVPA 439

  Fly   197 LTHPRSLVAIWCTNSTLHQLALEQQLLPSWNLRLLHKLRWYKLSTDHELIAPPQSDLTQKQPYEM 261
            | ....|:.:|.|...:.   |.:..|..|....:.:|.|.|.:....:|...::........|.
  Fly   440 L-QDDGLIFLWVTGRAME---LGRDCLKLWGYERVDELIWVKTNQLQRIIRTGRTGHWLNHGKEH 500

  Fly   262 LYVACRSDASENYGKDIQQTELIFSVPSIVHSHKPPLLSWLREHLLLDKDQLEPNC--LELFAR- 323
            ..|..:.:.: |..:.:....::..|.:.  ||||..:..:.|       :|.|..  :|||.| 
  Fly   501 CLVGMKGNPT-NLNRGLDCDVIVAEVRAT--SHKPDEIYGIIE-------RLSPGTRKIELFGRP 555

  Fly   324 -YLHPHFTSIG--LEVLKLMDERL 344
             .:.|::.::|  |:.::|:|..|
  Fly   556 HNIQPNWITLGNQLDGIRLVDPEL 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14906NP_650573.1 MT-A70 155..335 CDD:282866 36/185 (19%)
Mettl3NP_651204.1 MT-A70 407..568 CDD:282866 36/183 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.