DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14906 and Mettl4

DIOPT Version :9

Sequence 1:NP_650573.1 Gene:CG14906 / 42030 FlyBaseID:FBgn0015351 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_038939714.1 Gene:Mettl4 / 316731 RGDID:1306451 Length:474 Species:Rattus norvegicus


Alignment Length:288 Identity:95/288 - (32%)
Similarity:141/288 - (48%) Gaps:47/288 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SLEDLHLVNEYLELLSKPVEPEDSSPMKRHWEDGYNVPQLHGANESGRMQRFLRVDGSRGVYLIP 131
            ||.|:.|  :.|:|:...|...:.....|..|:          |.|  ..:.:.:.|.|  ||:|
  Rat   212 SLNDMEL--QTLQLMGDDVFVTELDLSSRIIEN----------NSS--FSKMITLMGQR--YLLP 260

  Fly   132 NQSRFFNHNVDNLPALLHQLLPAYDLIVLDPPWRNKYIRRLKRAKPELGYSMLSNEQLSHIPLSK 196
            .:|.|...::..:..||: ....:|:||:||||.||.::|..|      |:.||.:|:..:|:.|
  Rat   261 PKSSFLLSDISCMQPLLN-CSKTFDVIVIDPPWENKSVKRSNR------YNSLSPQQIKRMPVPK 318

  Fly   197 LTHPRSLVAIWCTNSTLHQLALEQQLLPSWNLRLLHKLRWYKLSTDHELIAPPQSDLTQKQPYEM 261
            |..|..||..|.||...|...::::|.|||::.::.:..|.|::...|.:.|  .|...|:|||.
  Rat   319 LAAPDCLVVTWVTNRQKHLCFVKEELYPSWSVEVIAEWYWVKITNSGEFVFP--LDSLHKKPYEC 381

  Fly   262 LY---------VACRSDASENYGKDIQQTELIFSVPSIVHSHKPPLLSWLREHLLLDKDQLEP-- 315
            |.         :|.|::|...  ..:....||.|||..:|||||||...|       ||.::|  
  Rat   382 LVLGRVKEKTALALRNEAVRT--PPVPDQRLIVSVPCALHSHKPPLAEVL-------KDYIKPGG 437

  Fly   316 NCLELFARYLHPHFTSIGLEVLKL--MD 341
            .|||||||.|.|.:.|.|.||||.  ||
  Rat   438 QCLELFARNLQPGWMSWGNEVLKFQHMD 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14906NP_650573.1 MT-A70 155..335 CDD:282866 69/190 (36%)
Mettl4XP_038939714.1 MT-A70 283..457 CDD:382774 69/190 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337082
Domainoid 1 1.000 114 1.000 Domainoid score I5954
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H35305
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1496188at2759
OrthoFinder 1 1.000 - - FOG0004635
OrthoInspector 1 1.000 - - oto97905
orthoMCL 1 0.900 - - OOG6_105628
Panther 1 1.100 - - LDO PTHR12829
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3250
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.