DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14906 and mettl4

DIOPT Version :9

Sequence 1:NP_650573.1 Gene:CG14906 / 42030 FlyBaseID:FBgn0015351 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_012820781.2 Gene:mettl4 / 100379768 XenbaseID:XB-GENE-992320 Length:417 Species:Xenopus tropicalis


Alignment Length:412 Identity:115/412 - (27%)
Similarity:174/412 - (42%) Gaps:105/412 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EDSKFAVFLDHKTLINEA---YDEFKLKSELFQF---HAKKTDKGIE------------EDKTRK 55
            |.|.|..:..|.|...:|   .:::.::.:||..   |..|....:.            .::.:|
 Frog    15 ELSLFRKWYQHSTSCQDADHKKNQYGIRGDLFLILRPHIPKQSTPVSLPTVCPETNPTATNQKKK 79

  Fly    56 RKRKA----GVEDASSLEDLH-------------LVNE-----YLELLS-----KPVEP------ 87
            |||..    |..||.   |.|             |:.|     :|:.||     ...||      
 Frog    80 RKRSCAFNQGELDAM---DYHKKITDFILEGTQPLIQEGFKKLFLQALSVNDNHSQTEPGLCNNP 141

  Fly    88 ---------EDSSPMKRH-------WEDGYNVPQ--------LHGANESGRMQRFLRVDGSRGVY 128
                     ..|.|:...       .|.|..:||        ....:|..::..|:   |.:  |
 Frog   142 CQLAELCNMAKSMPLLNFGEHTVLVLESGLYLPQETNVLSCITENKSECPKVIHFI---GEK--Y 201

  Fly   129 LIPNQSRFFNHNVDNLPALLHQLLPAYDLIVLDPPWRNKYIRRLKRAKPELGYSMLSNEQLSHIP 193
            :||.:|.|...:|..:..||.  ...|::||:||||.||.::|.||      |:.||..::..:|
 Frog   202 IIPPKSAFLMSDVSCMEPLLQ--YKKYNIIVMDPPWENKSVKRSKR------YNSLSPNEIQQLP 258

  Fly   194 LSKLTHPRSLVAIWCTNSTLHQLALEQQLLPSWNLRLLHKLRWYKLSTDHELIAPPQSDLTQKQP 258
            :..|..|..||..|.||...|...:::.|.|.|::|.|.:..|.|::...|.:.|  .|...|:|
 Frog   259 VPALAAPDCLVITWVTNKQKHLRFVKEDLYPQWSVRTLGEWHWVKITRSGEFVFP--LDSNHKKP 321

  Fly   259 YEMLYVACRSDASENYGKD-------IQQTELIFSVPSIVHSHKPPLLSWLREHLLLDKDQLEPN 316
            ||:|.:........:.|::       |.:.:||.|||..:|||||||...|:|::..|.:     
 Frog   322 YEVLVLGRFQGTVNSAGRESGISLPPIPERKLIVSVPCKLHSHKPPLSEVLKEYVKPDVE----- 381

  Fly   317 CLELFARYLHPHFTSIGLEVLK 338
            |||||||.|.|.:||.|.||||
 Frog   382 CLELFARNLQPGWTSWGNEVLK 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14906NP_650573.1 MT-A70 155..335 CDD:282866 68/186 (37%)
mettl4XP_012820781.2 MT-A70 226..400 CDD:382774 68/186 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5710
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H35305
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1496188at2759
OrthoFinder 1 1.000 - - FOG0004635
OrthoInspector 1 1.000 - - oto104597
Panther 1 1.100 - - LDO PTHR12829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3250
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.020

Return to query results.
Submit another query.